Crystal structure of the ILK/alpha-parvin core complex (apo). Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Dec 2009.
Explore 3KMU in 3D Show helices and sheets RCSB PDB PDBe
3KMU contains 29 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 190-192 | 3 | |
| β-strand | 194-202 | 9 | 1 |
| β-strand | 205-212 | 8 | 1 |
| β-strand | 215-222 | 8 | 1 |
| α-helix | 223 | 1 | |
| α-helix | 229-238 | 10 | |
| α-helix | 239-242 | 4 | |
| β-strand | 250-251 | 2 | 2 |
| β-strand | 253-257 | 5 | 1 |
| β-strand | 266-270 | 5 | 1 |
| β-strand | 276 | 1 | 2 |
| α-helix | 277-282 | 6 | |
| α-helix | 291-308 | 18 | |
| α-helix | 314-315 | 2 | |
| α-helix | 322-324 | 3 | |
| β-strand | 325-327 | 3 | 2 |
| β-strand | 333-336 | 4 | 2 |
| α-helix | 337-339 | 3 | |
| α-helix | 341-342 | 2 | |
| β-strand | 350 | 1 | 3 |
| α-helix | 353-355 | 3 | |
| α-helix | 358-362 | 5 | |
| α-helix | 365-367 | 3 | |
| α-helix | 370-387 | 18 | |
| α-helix | 397-406 | 10 | |
| α-helix | 413-414 | 2 | |
| α-helix | 419-428 | 10 | |
| α-helix | 433-435 | 3 | |
| α-helix | 437-438 | 2 | |
| α-helix | 439-449 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 250-255 | 6 | |
| α-helix | 258-276 | 19 | |
| α-helix | 277-279 | 3 | |
| α-helix | 294-304 | 11 | |
| β-strand | 307 | 1 | 3 |
| α-helix | 310-312 | 3 | |
| α-helix | 320-336 | 17 | |
| α-helix | 339-342 | 4 | |
| α-helix | 346-350 | 5 | |
| α-helix | 354-368 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Integrin-linked kinase | A | protein | 271 | Homo sapiens | Q13418 (AlphaFold model) |
| Alpha-parvin | B | protein | 129 | Homo sapiens | Q9NVD7 (AlphaFold model) |
>3KMU_1 Integrin-linked kinase (chains A) MNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR LRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDM ARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQSPGRMYAPAWVAPEAL QKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHV SKLMKICMNEDPAKRPKFDMIVPILEKMQDK
>3KMU_2 Alpha-parvin (chains B) GSHMDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLL EGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYN LFTKYRNVE
The pseudoactive site of ILK is essential for its binding to alpha-Parvin and localization to focal adhesions. Fukuda, K., Gupta, S., Chen, K. et al. Mol Cell (2009) 36:819-830. DOI 10.1016/j.molcel.2009.11.028 · PubMed
Other PDB entries of the same protein (UniProt Q13418 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3KMU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.