4HI9: Integrin-linked protein kinase

1.2 structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1 domain collected at wavelength 0.91974. Determined by X-ray diffraction at 1.2 Å resolution. Released 11 Dec 2013.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,231
Mol. weight: 30.04 kDa
Ligands: PO4, ZN
Released: 11 Dec 2013

Explore 4HI9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HI9 contains 13 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	13-21	9
α-helix	37-43	7
α-helix	47-55	9
α-helix	70-76	7
α-helix	80-88	9
α-helix	103-109	7
α-helix	113-121	9
β-strand	128	1	1
α-helix	136-139	4
α-helix	142-154	13
β-strand	162	1	1

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	-2-1	4	2
β-strand	22-26	5	2
β-strand	29-32	4	2
α-helix	44-45	2
α-helix	46-48	3
β-strand	51-53	3	3
β-strand	56-58	3	3
α-helix	60-66	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin-linked protein kinase	A	protein	179	Homo sapiens	Q13418 (AlphaFold model)
LIM and senescent cell antigen-like-containing domain protein 1	B	protein	72	Homo sapiens	P48059 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HI9_1 Integrin-linked protein kinase (chains A)
GSPEFMDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIM
RGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQV
AEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTR

Sequence of entity 2 (B), FASTA

>4HI9_2 LIM and senescent cell antigen-like-containing domain protein 1 (chains B)
SENLYFQGSASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGR
KYCEHDFQMLFA

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
ZN	Zinc ion	Zn	2

Water and common crystallization additives (IOD) are not listed.

Primary citation

1.2 structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1 domain collected at wavelength 0.91974. Stiegler, A.L., Jakoncic, J., Stojanoff, V. et al. To be published.

Other PDB entries of the same protein (UniProt Q13418 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HI8 1.2 Å, Structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1…
9TP9 1.45 Å, Crystal structure of integrin-linked kinase (ILK) in complex with Alpha-Parvin and…
9D5E 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to gefitinib
9D5F 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to bosutinib
9D5H 1.5 Å, Crystal structure of the ILK mutant (R371Q)/alpha-parvin core complex bound to gefitinib
9D5I 1.5 Å, Crystal structure of the ILK mutant (R225A)/alpha-parvin core complex bound to MgATP
9D5P 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to erlotinib
9TPD 1.5 Å, Crystal structure of integrin-linked kinase (ILK) in complex with alpha-parvin and a…
9D5G 1.55 Å, Crystal structure of the ILK/alpha-parvin core complex bound to 4-methyl erlotinib
3F6Q 1.6 Å, Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
3KMU 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (apo)
3REP 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (MnATP)

Browse structure collections

About this viewer

MolViewer shows 4HI9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.