3KVD: Lipoprotein

Crystal structure of the Neisseria meningitidis Factor H binding protein, fHbp (GNA1870) at 2.0 A resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 29 Dec 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Neisseria meningitidis
Chains: 1
Atoms: 2,017
Mol. weight: 25.97 kDa
Released: 29 Dec 2010

Explore 3KVD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KVD contains 7 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	81-86	6
α-helix	88-89	2
β-strand	99-100	2	1
β-strand	110-115	6	2
β-strand	118-122	5	2
β-strand	127-128	2	1
α-helix	130-132	3
α-helix	134	1
β-strand	138-149	12	2
β-strand	152-165	14	2
β-strand	169-180	12	2
β-strand	188-201	14	2
β-strand	203	1	3
α-helix	204	1
β-strand	205	1	4
α-helix	206-208	3
β-strand	214-223	10	3
β-strand	226-236	11	3
β-strand	241-247	7	3
α-helix	252-254	3
β-strand	257-265	9	3
β-strand	270	1	4
β-strand	271-279	9	3
β-strand	282-292	11	3
β-strand	298-307	10	3
β-strand	310-319	10	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lipoprotein	D	protein	242	Neisseria meningitidis	Q6QCC2 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>3KVD_1 Lipoprotein (chains D)
AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKV
SRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGD
IAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDL
AAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAA
KQ

Primary citation

Structure of the uncomplexed Neisseria meningitidis factor H-binding protein fHbp (rLP2086). Cendron, L., Veggi, D., Girardi, E. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2011) 67:531-535. DOI 10.1107/S1744309111006154 · PubMed

Other PDB entries of the same protein (UniProt Q6QCC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TIK 3.4 Å, Hepatitis B virus core shell--virus-like particle with NadA epitope
2KC0 Solution structure of the factor H binding protein

Browse structure collections

About this viewer

MolViewer shows 3KVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.