3L01: GlgA glycogen synthase

Crystal structure of monomeric glycogen synthase from Pyrococcus abyssi. Determined by X-ray diffraction at 2.6 Å resolution. Released 29 Dec 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Pyrococcus abyssi
Chains: 2
Atoms: 7,011
Mol. weight: 98.3 kDa
Released: 29 Dec 2010

Explore 3L01 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L01 contains 49 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	10	1	2
β-strand	13	1	2
α-helix	18-31	14
β-strand	35-41	7	1
β-strand	49-56	8	1
β-strand	59-70	12	1
β-strand	73-79	7	1
α-helix	81-84	4
α-helix	92-115	24
α-helix	119-121	3
β-strand	123-127	5	1
α-helix	129-131	3
α-helix	132-142	11
β-strand	146-150	5	1
β-strand	158-159	2	3
α-helix	161-165	5
α-helix	169-171	3
β-strand	176-177	2	3
α-helix	179-186	8
β-strand	189-192	4	1
α-helix	195-200	6
α-helix	202-205	4
α-helix	206-208	3
β-strand	212-214	3	1
α-helix	226-228	3
α-helix	233-242	10
β-strand	250-255	6	4
β-strand	258	1	5
α-helix	265-275	11
α-helix	280-283	4
β-strand	284-289	6	4
β-strand	292	1	5
α-helix	294-306	13
β-strand	310-313	4	4
α-helix	316-318	3
α-helix	319-326	8
β-strand	331-334	4	4
α-helix	343-350	8
α-helix	353	1
β-strand	354-358	5	4
α-helix	362-366	5
β-strand	373-375	3	4
α-helix	380-393	14
α-helix	398-409	12
α-helix	414-425	12

Chain B: 24 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	6
β-strand	10	1	7
β-strand	13	1	7
α-helix	18-31	14
β-strand	35-41	7	6
β-strand	49-56	8	6
β-strand	59-70	12	6
β-strand	73-79	7	6
α-helix	81-84	4
α-helix	92-115	24
α-helix	119-121	3
β-strand	123-127	5	6
α-helix	129-131	3
α-helix	132-142	11
β-strand	146-150	5	6
β-strand	158-159	2	8
α-helix	161-165	5
α-helix	169-171	3
β-strand	176-177	2	8
α-helix	179-186	8
β-strand	189-192	4	6
α-helix	195-200	6
α-helix	202-205	4
α-helix	206-208	3
β-strand	212-214	3	6
α-helix	226-228	3
α-helix	233-242	10
β-strand	250-255	6	9
β-strand	258	1	10
α-helix	265-275	11
α-helix	279-282	4
β-strand	284-289	6	9
β-strand	292	1	10
α-helix	294-306	13
β-strand	310-313	4	9
α-helix	319-326	8
β-strand	331-334	4	9
α-helix	343-350	8
α-helix	353	1
β-strand	354-358	5	9
α-helix	363-366	4
β-strand	373-375	3	9
α-helix	380-393	14
α-helix	398-409	12
α-helix	414-425	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GlgA glycogen synthase	A, B	protein	428	Pyrococcus abyssi	Q9V2J8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3L01_1 GlgA glycogen synthase (chains A, B)
RHMKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFG
EEVQVKVSYEERGNLRIYRIGGGLLDSEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREE
PLPDVVHFHDWHTVFAGALIKKYFKIPAVFTIHRLNKSKLPAFYFHEAGLSELAPYPDID
PEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDERKK
SLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEG
WARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIAS
AVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSWEKSA
ERYVKAYA

Primary citation

Processivity and Subcellular Localization of Glycogen Synthase Depend on a Non-catalytic High Affinity Glycogen-binding Site. Diaz, A., Martinez-Pons, C., Fita, I. et al. J Biol Chem (2011) 286:18505-18514. DOI 10.1074/jbc.M111.236109 · PubMed

Other PDB entries of the same protein (UniProt Q9V2J8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BFW 1.8 Å, Structure of the C domain of glycogen synthase from Pyrococcus abyssi
5WQC 1.96 Å, Crystal structure of human orexin 2 receptor bound to the selective antagonist EMPA…
6HLP 2.2 Å, Crystal structure of the Neurokinin 1 receptor in complex with the small molecule…
5WS3 2.3 Å, Crystal structures of human orexin 2 receptor bound to the selective antagonist EMPA…
6HLO 2.4 Å, Crystal structure of the Neurokinin 1 receptor in complex with the small molecule…
3FRO 2.5 Å, Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed…
4S0V 2.5 Å, Crystal structure of the human OX2 orexin receptor bound to the insomnia drug Suvorexant
6FJ3 2.5 Å, High resolution crystal structure of parathyroid hormone 1 receptor in complex with a…
5U09 2.6 Å, High-resolution crystal structure of the human CB1 cannabinoid receptor
6TPN 2.61 Å, Crystal structure of the Orexin-2 receptor in complex with HTL6641 at 2.61 A resolution
7FEE 2.7 Å, Crystal structure of the allosteric modulator ZCZ011 binding to CP55940-bound…
6TPJ 2.74 Å, Crystal structure of the Orexin-2 receptor in complex with suvorexant at 2.76 A resolution

Browse structure collections

About this viewer

MolViewer shows 3L01 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.