3L0W: Proliferating cell nuclear antigen

Structure of split monoubiquitinated PCNA with ubiquitin in position two. Determined by X-ray diffraction at 2.8 Å resolution. Released 23 Mar 2010.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,590
Mol. weight: 37.95 kDa
Released: 23 Mar 2010

Explore 3L0W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L0W contains 12 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
α-helix	9-19	11
β-strand	25-26	2	2
β-strand	27-31	5	3
β-strand	34-40	7	3
β-strand	46-53	8	3
α-helix	54-56	3
β-strand	59-61	3	1
β-strand	66-67	2	3
β-strand	70-71	2	2
α-helix	72-80	9
β-strand	89-92	4	1
β-strand	98-104	7	1
β-strand	111-117	7	1
β-strand	135-140	6	3
α-helix	141-151	11
β-strand	157-162	6	4

Chain B: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	5
β-strand	12-16	5	5
β-strand	22	1	6
α-helix	23-34	12
β-strand	41-43	3	5
β-strand	44-45	2	7
β-strand	48-49	2	7
α-helix	50-51	2
β-strand	55	1	6
α-helix	56-59	4
β-strand	66-71	6	5
β-strand	81-86	6	4
β-strand	91-96	6	4
β-strand	99	1	8
α-helix	105-107	3
β-strand	109	1	8
β-strand	110-113	4	3
β-strand	117-122	6	4
α-helix	123-129	7
α-helix	130-135	6
β-strand	138-143	6	3
α-helix	148	1
β-strand	149-155	7	3
β-strand	158-164	7	3
α-helix	165-167	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proliferating cell nuclear antigen	A	protein	169	Saccharomyces cerevisiae	P15873 (AlphaFold model)
Monoubiquitinated Proliferating cell nuclear antigen	B	protein	169	Saccharomyces cerevisiae	P05759 (AlphaFold model), P15873 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3L0W_1 Proliferating cell nuclear antigen (chains A)
HHHHHHMLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGV
EAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEY
SLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMIT

Sequence of entity 2 (B), FASTA

>3L0W_2 Monoubiquitinated Proliferating cell nuclear antigen (chains B)
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGGETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLT
FGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFN

Primary citation

Structure of monoubiquitinated PCNA and implications for translesion synthesis and DNA polymerase exchange. Freudenthal, B.D., Gakhar, L., Ramaswamy, S. et al. Nat Struct Mol Biol (2010) 17:479-484. DOI 10.1038/nsmb.1776 · PubMed

Other PDB entries of the same protein (UniProt P15873 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V7M 1.93 Å, PCNA mutant L126A/I128A Protein Defective in Gene Silencing
8DQX 2.1 Å, Open state of RFC:PCNA bound to a 3' ss/dsDNA junction
8DR1 2.14 Å, Consensus closed state of RFC:PCNA bound to a 3' ss/dsDNA junction (DNA2)
8DR3 2.2 Å, Closed state of RFC:PCNA bound to a 3' ss/dsDNA junction (DNA2) with NTD
1PLQ 2.3 Å, Crystal structure of the eukaryotic DNA polymerase processivity factor pcna
8DR6 2.39 Å, Closed state of RFC:PCNA bound to a nicked dsDNA
8DR0 2.42 Å, Closed state of RFC:PCNA bound to a 3' ss/dsDNA junction
8DR4 2.45 Å, Open state of RFC:PCNA bound to a 3' ss/dsDNA junction (DNA2) without NTD
3GPN 2.5 Å, Structure of the non-trimeric form of the E113G PCNA mutant protein
3V60 2.6 Å, Structure of S. cerevisiae PCNA conjugated to SUMO on lysine 164
8THW 2.6 Å, Cac1 PIP motif bound to PCNA
6W9W 2.65 Å, R80A PCNA mutant defective in BIR

Browse structure collections

About this viewer

MolViewer shows 3L0W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.