Crystal Structure of U-box Domain of Human E4B Ubiquitin Ligase. Determined by X-ray diffraction at 2.6 Å resolution. Released 5 May 2010.
Explore 3L1X in 3D Show helices and sheets RCSB PDB PDBe
3L1X contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1230-1232 | 3 | |
| β-strand | 1233 | 1 | 1 |
| α-helix | 1239 | 1 | |
| β-strand | 1240 | 1 | 1 |
| α-helix | 1241 | 1 | |
| β-strand | 1244-1246 | 3 | 2 |
| β-strand | 1252-1254 | 3 | 2 |
| α-helix | 1255-1264 | 10 | |
| β-strand | 1267 | 1 | 3 |
| β-strand | 1274 | 1 | 3 |
| α-helix | 1277-1279 | 3 | |
| β-strand | 1281-1282 | 2 | 2 |
| α-helix | 1284-1298 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin conjugation factor E4 B | A | protein | 100 | Homo sapiens | O95155 (AlphaFold model) |
>3L1X_1 Ubiquitin conjugation factor E4 B (chains A) GSHKFAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHL LNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH
Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4. Benirschke, R.C., Thompson, J.R., Nomine, Y. et al. Structure (2010) 18:955-965. DOI 10.1016/j.str.2010.04.017 · PubMed
Other PDB entries of the same protein (UniProt O95155 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3L1X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.