3L5E: BACE

Structure of BACE Bound to SCH736062. Determined by X-ray diffraction at 1.53 Å resolution. Released 16 Feb 2010.

Method: X-ray diffraction
Resolution: 1.53 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,082
Mol. weight: 94.02 kDa
Ligands: BDW, TAR
Released: 16 Feb 2010

Explore 3L5E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L5E contains 26 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	67-70	4	1
β-strand	74-81	8	1
β-strand	86-93	8	1
β-strand	99-102	4	1
α-helix	115-117	3
β-strand	122-132	11	1
β-strand	135-147	13	1
β-strand	155-167	13	1
β-strand	178-181	4	1
α-helix	185-187	3
α-helix	197-204	8
β-strand	211-215	5	1
α-helix	224-229	6
β-strand	233-237	5	1
α-helix	242-244	3
β-strand	245-253	9	1
β-strand	257	1	2
β-strand	260	1	2
β-strand	261	1	3
β-strand	264-269	6	4
β-strand	272-273	2	4
α-helix	278-282	5
β-strand	286-288	3	3
β-strand	295-298	4	3
α-helix	299-312	14
α-helix	320-323	4
β-strand	329-331	3	5
α-helix	338-340	3
α-helix	342-343	2
β-strand	344-349	6	4
β-strand	355-361	7	4
α-helix	363-366	4
β-strand	367-370	4	5
β-strand	379-383	5	5
β-strand	385-388	4	3
β-strand	392-394	3	3
α-helix	396-399	4
β-strand	402-407	6	1
β-strand	412-418	7	1
β-strand	430-436	7	4
α-helix	440-443	4

Chain B: 13 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	67-70	4	6
β-strand	74-81	8	6
β-strand	86-93	8	6
β-strand	99-102	4	6
α-helix	115-117	3
β-strand	122-130	9	6
β-strand	137-147	11	6
β-strand	155-166	12	6
β-strand	178-181	4	6
α-helix	185-187	3
α-helix	197-204	8
β-strand	211-215	5	6
α-helix	224-229	6
β-strand	233-237	5	6
α-helix	242-244	3
β-strand	245-253	9	6
β-strand	257	1	7
β-strand	260	1	7
β-strand	261	1	8
β-strand	264-269	6	9
β-strand	272-273	2	9
α-helix	278-281	4
β-strand	286-288	3	8
β-strand	295-298	4	8
α-helix	299-312	14
α-helix	320-323	4
β-strand	329-331	3	10
α-helix	338-340	3
α-helix	342-343	2
β-strand	344-349	6	9
β-strand	355-361	7	9
α-helix	363-366	4
β-strand	367-370	4	10
β-strand	379-383	5	10
β-strand	385-388	4	8
β-strand	392-394	3	8
α-helix	396-399	4
β-strand	402-407	6	6
β-strand	412-418	7	6
β-strand	430-436	7	9
α-helix	440-443	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-secretase 1	A, B	protein	414	Homo sapiens	P56817 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3L5E_1 Beta-secretase 1 (chains A, B)
LRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFA
VGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANI
AAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGF
PLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKE
YNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNI
FPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIME
GFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDEST

Ligands and cofactors

ID	Name	Formula	Copies
BDW	(4S)-1-(4-{[(2Z,4R)-4-(2-cyclohexylethyl)-4-(cyclohexylmethyl)-2-imino-5-oxoimi…	C32 H49 N5 O2	2
TAR	D(-)-tartaric acid	C4 H6 O6	3

Primary citation

Discovery of Cyclic Acylguanidines as Highly Potent and Selective beta-Site Amyloid Cleaving Enzyme (BACE) Inhibitors: Part I-Inhibitor Design and Validation. Zhu, Z., Sun, Z.Y., Ye, Y. et al. J Med Chem (2010) 53:951-965. DOI 10.1021/jm901408p · PubMed

Other PDB entries of the same protein (UniProt P56817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MYI 1.25 Å, BACE-1 in complex with compound #6
6UWP 1.29 Å, BACE-1 in complex with compound #32
6EQM 1.35 Å, Crystal Structure of Human BACE-1 in Complex with CNP520
4L7G 1.38 Å, Diethylaminosulfur Trifluoride-Mediated Intramolecular Cyclization of…
6EJ2 1.46 Å, BACE1 compound 28
6UWV 1.47 Å, BACE-1 in complex with compound #34
3VF3 1.48 Å, Crystal Structure of Human Beta Secretase in Complex with NVP-BQQ711
5HDZ 1.49 Å, BACE-1 in complex with (7aR)-7a-(5-cyanothiophen-2-yl)-6-(5-fluoro-4-methyl-6-(methylthio…
2QP8 1.5 Å, Structure of BACE Bound to SCH734723
4B78 1.5 Å, Aminoimidazoles as BACE-1 Inhibitors: From De Novo Design to Ab- lowering in Brain
4DJX 1.5 Å, Structure of BACE Bound to 5-(3-(5-chloropyridin-3-yl)phenyl)-5-cyclopropyl-2-imino-3-met…
5HU1 1.5 Å, BACE1 in complex with (R)-N-(3-(3-amino-2,5-dimethyl-1,1-dioxido-5,6-dihydro-2H-1,2,4-thi…

Browse structure collections

About this viewer

MolViewer shows 3L5E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.