Crystal Structure of Dengue Virus 1 NS2B/NS3 protease. Determined by X-ray diffraction at 2.2 Å resolution. Released 2 Mar 2010.
Explore 3L6P in 3D Show helices and sheets RCSB PDB PDBe
3L6P contains 5 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-13 | 7 | 1 |
| α-helix | 21 | 1 | |
| β-strand | 22-23 | 2 | 2 |
| β-strand | 33-34 | 2 | 3 |
| β-strand | 40-41 | 2 | 3 |
| α-helix | 68-69 | 2 | |
| β-strand | 71-78 | 8 | 1 |
| β-strand | 83-92 | 10 | 1 |
| β-strand | 95-99 | 5 | 1 |
| α-helix | 100-103 | 4 | |
| β-strand | 108-110 | 3 | 1 |
| β-strand | 113-115 | 3 | 1 |
| α-helix | 116 | 1 | |
| β-strand | 117-121 | 5 | 1 |
| β-strand | 126-129 | 4 | 1 |
| β-strand | 145-149 | 5 | 2 |
| β-strand | 157-161 | 5 | 2 |
| β-strand | 164-166 | 3 | 2 |
| β-strand | 173-176 | 4 | 2 |
| β-strand | 188-190 | 3 | 2 |
| β-strand | 196-203 | 8 | 2 |
| β-strand | 213-216 | 4 | 2 |
| α-helix | 219-221 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| fusion protein of nonstructural protein 2B and nonstructural protein 3 | A | protein | 236 | Dengue virus type 1 (strain Singapore/S275/1990), Dengue virus type 1 (strain Nauru/West Pac/1974) | P17763 (AlphaFold model) |
>3L6P_1 fusion protein of nonstructural protein 2B and nonstructural protein 3 (chains A) GAHMADLSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLGGGGSGGGG SGVLWDTPSPGIYRILQRGLLGRSQVGVGVFQEGVFHTMWHVTRGAVLMYQGKRLEPSWA SVKKDLISYGGGWRFQGSWNAGEEVQVIAVEPGKNPKNVQTAPGTFKTPEGEVGAIALDF KPGTSGSPIVNREGKIVGLYGNGVVTTSGTYVSAIAQAKASQEGPLPEIEDEVFRK
Water and common crystallization additives (SO4) are not listed.
Serotype-specific structural differences in the protease-cofactor complexes of the dengue virus family. Chandramouli, S., Joseph, J.S., Daudenarde, S. et al. J Virol (2010) 84:3059-3067. DOI 10.1128/JVI.02044-09 · PubMed
Other PDB entries of the same protein (UniProt P17763 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3L6P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.