4OIG: Dengue Virus Non-structural Protein NS1

Dengue Virus Non-structural Protein NS1. Determined by X-ray diffraction at 2.69 Å resolution. Released 5 Mar 2014.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Dengue virus 1
Chains: 4
Atoms: 5,771
Mol. weight: 86.79 kDa
Released: 5 Mar 2014

Explore 4OIG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OIG contains 43 α-helices and 61 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	185-189	5	1
β-strand	192-196	5	1
β-strand	200-207	8	1
β-strand	209-217	9	1
α-helix	223-226	4
α-helix	227-229	3
β-strand	231	1	2
α-helix	238-240	3
α-helix	245-247	3
α-helix	253-255	3
α-helix	268-270	3
β-strand	273-277	5	1
α-helix	279-280	2
β-strand	284-287	4	3
β-strand	298-299	2	1
β-strand	301	1	4
α-helix	306	1
β-strand	307	1	4
α-helix	308	1
β-strand	310-313	4	3
α-helix	320	1
β-strand	321-324	4	1
β-strand	329-331	3	1
β-strand	336-337	2	3
β-strand	347	1	1

Chain B: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	181-183	3
β-strand	185-189	5	1
β-strand	192-196	5	1
β-strand	200-207	8	1
β-strand	209-217	9	1
α-helix	223-226	4
α-helix	227-229	3
β-strand	231	1	2
α-helix	238-240	3
α-helix	245-247	3
α-helix	253-255	3
α-helix	268-270	3
β-strand	273-277	5	1
α-helix	279-280	2
β-strand	284-287	4	5
β-strand	298	1	6
β-strand	299	1	1
β-strand	301	1	7
α-helix	306	1
β-strand	307	1	7
α-helix	308	1
β-strand	310-313	4	5
α-helix	320	1
β-strand	321-324	4	1
β-strand	329-331	3	1
β-strand	335-337	3	5
β-strand	347	1	6

Chains D and E: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	181-183	3
β-strand	185-189	5	8
β-strand	192-196	5	8
β-strand	200-207	8	8
β-strand	209-217	9	8
α-helix	223-226	4
α-helix	227-229	3
β-strand	231	1	9
α-helix	238-240	3
α-helix	245-247	3
α-helix	253-255	3
α-helix	268-270	3
β-strand	273-277	5	8
α-helix	279-280	2
β-strand	284-287	4	10
β-strand	298-299	2	8
β-strand	301	1	11
α-helix	306	1
β-strand	307	1	11
α-helix	308	1
β-strand	310-313	4	10
α-helix	320	1
β-strand	321-324	4	8
β-strand	329-331	3	8
β-strand	335-337	3	10
β-strand	347	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1, NS1	A, B, D, E	protein	185	Dengue virus 1	P17763 (AlphaFold model)

Sequence of entity 1 (A, B, D, E), FASTA

>4OIG_1 Non-structural protein 1, NS1 (chains A, B, D, E)
MASMRDSYTQVCDHRLMSAAIKDSKAVHADMGYWIESEKNETWKLARASFIEVKTCIWPK
SHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVV
DEHCGNRGPSLRTTTVTGKTIHEWCCRSCTLPPLRFKGEDGCWYGMEIRPVKEKEENLVK
SMVSA

Primary citation

Structural basis of Flavivirus NS1 assembly and antibody recognition. Edeling, M.A., Diamond, M.S., Fremont, D.H. Proc Natl Acad Sci U S A (2014) 111:4285-4290. DOI 10.1073/pnas.1322036111 · PubMed

Other PDB entries of the same protein (UniProt P17763 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LCY 1.6 Å, Crystal structure of HLA-b46 at 1.6 angstrom resolution
4AL8 1.66 Å, Structure of Dengue virus DIII in complex with Fab 2H12
4GSX 1.9 Å, High resolution structure of dengue virus serotype 1 sE containing stem
3LKW 2.0 Å, Crystal Structure of Dengue Virus 1 NS2B/NS3 protease active site mutant
3L6P 2.2 Å, Crystal Structure of Dengue Virus 1 NS2B/NS3 protease
4GT0 2.57 Å, Structure of dengue virus serotype 1 sE containing stem to residue 421
8VPR 2.7 Å, Crystal structure of mouse Importin alpha in complex with Dengue 1 NS5 central NLS peptide
5WKF 2.95 Å, D30 TCR in complex with HLA-A*11:01-GTS1
5VIC 3.0 Å, Crystal structure of anti-Zika antibody Z004 bound to DENV-1 Envelope protein DIII
5WJL 3.15 Å, Crystal Structure of HLA-A*11:01 with GTS1 peptide
7DWT 19.0 Å, Cryo-EM structure of Dengue virus serotype 1 strain WestPac 74 in complex with human…
7DWU 19.0 Å, Cryo-EM structure of Dengue virus serotype 1 strain WestPac 74 in complex with human…

Browse structure collections

About this viewer

MolViewer shows 4OIG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.