3LQX: SRP ribonucleoprotein core

SRP ribonucleoprotein core complexed with cobalt hexammine. Determined by X-ray diffraction at 1.93 Å resolution. Released 2 Mar 2010.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,741
Mol. weight: 30.03 kDa
Ligands: NCO
Released: 2 Mar 2010

Explore 3LQX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LQX contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-7	5
α-helix	24-33	10
α-helix	37-41	5
α-helix	43-45	3
α-helix	48-57	10
α-helix	62-79	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle protein	A	protein	105	Escherichia coli	P0AGD7 (AlphaFold model)
Srp RNA	B	RNA	49

Sequence of entity 1 (A), FASTA

>3LQX_1 Signal recognition particle protein (chains A)
GFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKE
RAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKMKK

Sequence of entity 2 (B), FASTA

>3LQX_2 SRP RNA (chains B)
GGCUCUGUUUACCAGGUCAGGUCCGAAAGGAAGCAGCCAAGGCAGAGCC

Ligands and cofactors

ID	Name	Formula	Copies
NCO	Cobalt hexammine(iii)	Co H18 N6	8

Water and common crystallization additives (CL, K) are not listed.

Primary citation

Structural and Energetic Analysis of Metal Ions Essential to SRP Signal Recognition Domain Assembly. Batey, R.T., Doudna, J.A. Biochemistry (2002) 41:11703-11710. PubMed

Other PDB entries of the same protein (UniProt P0AGD7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HQ1 1.52 Å, Structural and energetic analysis of RNA recognition by a universally conserved protein…
1DUL 1.8 Å, Structure of the ribonucleoprotein core of the E. Coli signal recognition particle
2PXD 2.0 Å, Variant 1 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXE 2.0 Å, Variant 4 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXF 2.0 Å, Variant 5 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXV 2.0 Å, Variant 6 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
7O9I 2.49 Å, Escherichia coli Ffh in complex with pppGpp
2PXB 2.5 Å, Variant 2 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXK 2.5 Å, Variant 8 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXL 2.5 Å, Variant 9 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXP 2.5 Å, Variant 13 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXQ 2.5 Å, Variant 14 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle

Browse structure collections

About this viewer

MolViewer shows 3LQX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.