Crystal structure of human RIG-I CTD bound to a 12 bp AU rich 5' ppp dsRNA. Determined by X-ray diffraction at 2.15 Å resolution. Released 2 Jun 2010.
Explore 3LRR in 3D Show helices and sheets RCSB PDB PDBe
3LRR contains 8 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 806-810 | 5 | 1 |
| β-strand | 816-819 | 4 | 1 |
| α-helix | 820-822 | 3 | |
| β-strand | 823-826 | 4 | 2 |
| β-strand | 830-833 | 4 | 2 |
| α-helix | 836-839 | 4 | |
| β-strand | 842-846 | 5 | 2 |
| β-strand | 852-853 | 2 | 2 |
| β-strand | 856-864 | 9 | 2 |
| β-strand | 872-879 | 8 | 2 |
| β-strand | 882-887 | 6 | 2 |
| α-helix | 889-891 | 3 | |
| β-strand | 892-896 | 5 | 1 |
| β-strand | 902-903 | 2 | 1 |
| β-strand | 917 | 1 | 2 |
| α-helix | 920-922 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 806-810 | 5 | 3 |
| β-strand | 816-819 | 4 | 3 |
| α-helix | 820-822 | 3 | |
| β-strand | 823-826 | 4 | 4 |
| β-strand | 830-833 | 4 | 4 |
| α-helix | 836-839 | 4 | |
| β-strand | 842-852 | 11 | 4 |
| β-strand | 856-864 | 9 | 4 |
| β-strand | 872-879 | 8 | 4 |
| β-strand | 882-887 | 6 | 4 |
| α-helix | 889-891 | 3 | |
| β-strand | 892-896 | 5 | 3 |
| β-strand | 902-903 | 2 | 3 |
| β-strand | 916-917 | 2 | 4 |
| α-helix | 918 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Probable ATP-dependent RNA helicase DDX58 | A, B | protein | 121 | Homo sapiens | O95786 (AlphaFold model) |
| RNA (5'-r(*(atp)p*up*ap*up*ap*up*ap*up*ap*up*ap*u)-3') | C, D | RNA | 12 |
>3LRR_1 Probable ATP-dependent RNA helicase DDX58 (chains A, B) KENKKLLCRKCKALACYTADVRVIEESHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKI FCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAE M
>3LRR_2 RNA (5'-R(*(ATP)P*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*U)-3') (chains C, D) XUAUAUAUAUAU
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
The Structural Basis of 5' Triphosphate Double-Stranded RNA Recognition by RIG-I C-Terminal Domain. Lu, C., Xu, H., Ranjith-Kumar, C.T. et al. Structure (2010) 18:1032-1043. DOI 10.1016/j.str.2010.05.007 · PubMed
Other PDB entries of the same protein (UniProt O95786 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3LRR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.