3OG8: Human RIG-I CTD

Crystal structure of human RIG-I CTD bound to a 14-bp blunt-ended dsRNA. Determined by X-ray diffraction at 2.4 Å resolution. Released 3 Nov 2010.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Homo sapiens, Synthetic construct
Chains: 4
Atoms: 2,829
Mol. weight: 39.24 kDa
Ligands: ZN
Released: 3 Nov 2010

Explore 3OG8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OG8 contains 13 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	806-810	5	1
β-strand	816-819	4	1
α-helix	820-822	3
β-strand	823-826	4	2
β-strand	830-833	4	2
α-helix	838-840	3
β-strand	842-846	5	3
β-strand	852-853	2	4
β-strand	856-857	2	4
β-strand	860-864	5	3
β-strand	872-879	8	3
β-strand	882-887	6	3
α-helix	889-891	3
β-strand	892-896	5	1
β-strand	902-903	2	1
α-helix	908-910	3
α-helix	916	1
β-strand	917	1	2
α-helix	918	1
α-helix	920-927	8

Chain B: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	806-810	5	5
β-strand	816-819	4	5
α-helix	820-822	3
β-strand	823-826	4	6
β-strand	830-833	4	6
α-helix	836-839	4
β-strand	842-845	4	6
β-strand	852-853	2	6
β-strand	856-864	9	6
β-strand	872-879	8	6
β-strand	882-887	6	6
α-helix	889-891	3
β-strand	892-896	5	5
β-strand	902-903	2	5
α-helix	908-910	3
β-strand	916-917	2	6
α-helix	918	1
α-helix	920-927	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Antiviral innate immune response receptor RIG-I	A, B	protein	128	Homo sapiens	O95786 (AlphaFold model)
RNA (5'-r(gpgpcpgpcpgpcpgpcpgpcpgpcpc)-3')	C, D	RNA	14	Synthetic construct

Sequence of entity 1 (A, B), FASTA

>3OG8_1 Antiviral innate immune response receptor RIG-I (chains A, B)
MDKENKKLLCRKCKALACYTADVRVIEESHYTVLGDAFKECFVSRPHPKPKQFSSFEKRA
KIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDP
AEMSKLEH

Sequence of entity 2 (C, D), FASTA

>3OG8_2 RNA (5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*C)-3') (chains C, D)
GGCGCGCGCGCGCC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Crystal structure of RIG-I C-terminal domain bound to blunt-ended double-strand RNA without 5' triphosphate. Lu, C., Ranjith-Kumar, C.T., Hao, L. et al. Nucleic Acids Res (2011) 39:1565-1575. DOI 10.1093/nar/gkq974 · PubMed

Other PDB entries of the same protein (UniProt O95786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BAH 1.89 Å, Structure of RIG-I CTD bound to OH-RNA
7MK1 1.9 Å, Structure of a protein-modified aptamer complex
3LRR 2.15 Å, Crystal structure of human RIG-I CTD bound to a 12 bp AU rich 5' ppp dsRNA
9KU4 2.4 Å, Cryo-EM structure of E373A mutant RIG-I with 5'p-RNA
2YKG 2.5 Å, Structural insights into RNA recognition by RIG-I
3ZD7 2.5 Å, Snapshot 3 of RIG-I scanning on RNA duplex
3NCU 2.55 Å, Structural and functional insights into pattern recognition by the innate immune…
4BPB 2.58 Å, Structural insights into RNA recognition by rig-I
3LRN 2.6 Å, Crystal structure of human RIG-I CTD bound to a 14 bp GC 5' ppp dsRNA
9KTW 2.6 Å, Cryo-EM structure of wild type RIG-I with 5'p-RNA
5F9F 2.6 Å, Crystal structure of RIG-I helicase-RD in complex with 24-mer blunt-end hairpin RNA
2QFD 2.7 Å, Crystal structure of the regulatory domain of human RIG-I with bound Hg

Browse structure collections

About this viewer

MolViewer shows 3OG8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.