3LRU: HPRP8 Non-Native Subdomain

hPRP8 Non-Native Subdomain. Determined by X-ray diffraction at 1.85 Å resolution. Released 25 Aug 2010.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,708
Mol. weight: 36.88 kDa
Released: 25 Aug 2010

Explore 3LRU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LRU contains 15 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1840-1841	2	1
α-helix	1842-1850	9
α-helix	1854-1859	6
β-strand	1861-1865	5	1
β-strand	1868	1	2
β-strand	1869-1875	7	3
β-strand	1881-1887	7	3
β-strand	1895-1901	7	1
α-helix	1911-1913	3
β-strand	1914-1918	5	4
α-helix	1923-1925	3
α-helix	1929-1945	17
α-helix	1947-1953	7
α-helix	1973-1989	17

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1840	1	1
α-helix	1842-1850	9
β-strand	1860-1864	5	1
α-helix	1865-1866	2
β-strand	1868	1	2
α-helix	1872	1
β-strand	1873-1875	3	4
β-strand	1881-1885	5	4
β-strand	1897-1901	5	1
α-helix	1902-1904	3
β-strand	1914-1918	5	3
α-helix	1923-1925	3
α-helix	1929-1945	17
α-helix	1947-1954	8
α-helix	1973-1989	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-mRNA-processing-splicing factor 8	A, B	protein	160	Homo sapiens	Q6P2Q9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3LRU_1 Pre-mRNA-processing-splicing factor 8 (chains A, B)
KRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQ
LPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRA
KVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD

Primary citation

Context-dependent remodeling of structure in two large protein fragments. Schellenberg, M.J., Ritchie, D.B., Wu, T. et al. J Mol Biol (2010) 402:720-730. DOI 10.1016/j.jmb.2010.08.020 · PubMed

Other PDB entries of the same protein (UniProt Q6P2Q9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JK8 1.15 Å, Open and closed forms of R1865A human PRP8 RNase H-like domain with bound Mg ion
4JKB 1.3 Å, Open and closed forms of V1788D human PRP8 RNase H-like domain with bound Mg ion
4JKA 1.32 Å, Open and closed forms of R1865A human PRP8 RNase H-like domain with bound Co ion
4JK7 1.4 Å, Open and closed forms of wild-type human PRP8 RNase H-like domain with bound Mg ion
4JK9 1.5 Å, Open and closed forms of wild-type human PRP8 RNase H-like domain with bound Co ion
4JKC 1.5 Å, Open and closed forms of T1800E human PRP8 RNase H-like domain with bound Mg ion
4JKD 1.55 Å, Open and closed forms of I1790Y human PRP8 RNase H-like domain with bound Mg ion
4JKE 1.65 Å, Open and closed forms of T1789P human PRP8 RNase H-like domain with bound Mg ion
4JKG 1.8 Å, Open and closed forms of mixed T1789P+R1865A and R1865A human PRP8 RNase H-like domain…
4JKH 1.8 Å, Open and closed forms of D1781E human PRP8 RNase H-like domain with bound Mg ion
3ENB 1.85 Å, Crystal Structure of PRP8 core domain IV
3E9L 1.95 Å, Crystal Structure of Human Prp8, Residues 1755-2016

Browse structure collections

About this viewer

MolViewer shows 3LRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.