3LTI: DNA-directed RNA polymerase subunit beta

Crystal structure of the Escherichia coli RNA polymerase beta subunit beta2-betai4 domains. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Oct 2010.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Escherichia coli
Chains: 1
Atoms: 2,731
Mol. weight: 34.64 kDa
Released: 20 Oct 2010

Explore 3LTI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LTI contains 16 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	154-159	6	1
β-strand	172-177	6	1
β-strand	180	1	2
β-strand	184-188	5	1
β-strand	194-198	5	1
β-strand	204-205	2	1
α-helix	207-212	6
α-helix	217-224	8
β-strand	227-233	7	3
β-strand	236-240	5	3
α-helix	243-246	4
β-strand	250	1	4
β-strand	255-257	3	5
β-strand	260-263	4	5
α-helix	267	1
β-strand	268	1	4
α-helix	269-270	2
α-helix	271-279	9
β-strand	284-286	3	3
α-helix	289-293	5
β-strand	296	1	6
β-strand	297	1	3
β-strand	301-302	2	7
β-strand	309-311	3	7
α-helix	315	1
β-strand	316	1	6
α-helix	317	1
α-helix	319-327	9
β-strand	332-336	5	3
α-helix	346-353	8
α-helix	359-370	12
α-helix	375-377	3
α-helix	378-389	12
β-strand	396	1	2
α-helix	398-408	11
α-helix	422-437	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit beta	A	protein	296	Escherichia coli	P0A8V2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LTI_1 DNA-directed RNA polymerase subunit beta (chains A)
GHPMSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPAT
IILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGR
RITARHIRQLEKDDVKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLLAKLSQ
SGHKRIETLFTNDLDHGPYISETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFEN
LFFSEDRYDLSAVGRMKFNRSLLREEIEGSGILSKDDIIDVMKKLIDIRNGKGEVD

Primary citation

Complete structural model of Escherichia coli RNA polymerase from a hybrid approach. Opalka, N., Brown, J., Lane, W.J. et al. PLoS Biol (2010) 8:e1000483. DOI 10.1371/journal.pbio.1000483 · PubMed

Other PDB entries of the same protein (UniProt P0A8V2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EGS 1.7 Å, The crystal structure of lobe domain of E. coli RNA polymerase complexed with the…
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…
9YMV 2.6 Å, De novo initial transcribing RNA polymerase with pretranslocated 3-mer RNA / product…

Browse structure collections

About this viewer

MolViewer shows 3LTI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.