9YMV: DNA-directed RNA polymerase subunit beta

De novo initial transcribing RNA polymerase with pretranslocated 3-mer RNA / product complex (RPitc3). Determined by electron microscopy at 2.6 Å resolution. Released 29 Apr 2026.

Method: Electron microscopy
Resolution: 2.6 Å
Organisms: Escherichia coli, Escherichia phage T7
Chains: 9
Atoms: 32,423
Mol. weight: 522.48 kDa
Ligands: ATP, ZN, MG, POP
Released: 29 Apr 2026

Explore 9YMV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9YMV contains 187 α-helices and 209 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-18	7	30
β-strand	23-31	9	30
α-helix	35-47	13
β-strand	52-61	10	31
β-strand	74	1	32
α-helix	78-86	9
β-strand	90-92	3	33
β-strand	97-105	9	31
β-strand	108-111	4	32
α-helix	112-114	3
β-strand	115	1	31
α-helix	116-117	2
β-strand	121-123	3	33
β-strand	129-133	5	32
β-strand	139-150	12	31
β-strand	152-153	2	34
α-helix	155-157	3
β-strand	170-172	3	31
β-strand	175-176	2	34
β-strand	180-189	10	30
β-strand	199-207	9	30
α-helix	213-227	15
α-helix	229-232	4

Chain H: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	35
β-strand	23-31	9	35
α-helix	35-49	15
β-strand	52-60	9	36
β-strand	74	1	37
α-helix	78-86	9
β-strand	90-92	3	38
β-strand	97-105	9	36
β-strand	108-110	3	37
α-helix	112-114	3
β-strand	115	1	36
α-helix	116-117	2
β-strand	121-123	3	38
β-strand	131-133	3	37
β-strand	139-150	12	36
β-strand	152-153	2	39
β-strand	171-172	2	36
β-strand	175-176	2	39
β-strand	180-190	11	35
β-strand	198-207	10	35
α-helix	213-226	14

Chain I: 65 helices, 89 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	11-12	2
β-strand	13-14	2	1
α-helix	19-20	2
α-helix	23-26	4
α-helix	29-39	11
α-helix	49-56	8
β-strand	59-60	2	2
β-strand	66-75	10	2
α-helix	82-88	7
β-strand	93-105	13	2
β-strand	114-128	15	2
β-strand	130	1	3
β-strand	136-138	3	3
β-strand	141-145	5	3
α-helix	146	1
β-strand	147-151	5	4
α-helix	152	1
β-strand	154-159	6	5
β-strand	172-177	6	5
β-strand	180	1	6
β-strand	184-188	5	5
β-strand	194-198	5	5
β-strand	204-205	2	5
α-helix	207-212	6
α-helix	217-224	8
β-strand	227-233	7	7
β-strand	236-239	4	7
α-helix	243-246	4
β-strand	250	1	8
β-strand	255-257	3	9
β-strand	260-263	4	9
β-strand	268	1	8
α-helix	271-279	9
β-strand	285-287	3	7
α-helix	289-292	4
β-strand	296-297	2	7
β-strand	301-303	3	10
β-strand	308-311	4	10
β-strand	315-316	2	7
α-helix	319-326	8
β-strand	332-336	5	7
α-helix	346-353	8
α-helix	359-370	12
α-helix	375-376	2
α-helix	378-389	12
β-strand	396	1	6
α-helix	398-408	11
α-helix	422-437	16
β-strand	451-454	4	4
α-helix	456-481	26
α-helix	496-508	13
β-strand	512-514	3	3
α-helix	515-516	2
α-helix	520-527	8
β-strand	529-531	3	4
α-helix	540-542	3
α-helix	550-551	2
α-helix	552-554	3
β-strand	558	1	11
β-strand	572-574	3	4
β-strand	575	1	11
β-strand	580-581	2	12
β-strand	587-595	9	12
β-strand	598-607	10	12
α-helix	608-611	4
β-strand	616-617	2	12
β-strand	623	1	13
β-strand	628	1	12
β-strand	629	1	13
β-strand	633-638	6	12
β-strand	641-646	6	12
α-helix	647-649	3
β-strand	652-654	3	12
α-helix	665-667	3
α-helix	671-673	3
α-helix	676-685	10
α-helix	686-688	3
β-strand	689	1	14
α-helix	690-691	2
β-strand	700-701	2	1
α-helix	705-711	7
β-strand	716-717	2	15
β-strand	722-728	7	16
β-strand	731-736	6	16
α-helix	737	1
α-helix	742	1
β-strand	748-752	5	16
β-strand	757-758	2	17
β-strand	763	1	18
β-strand	764-765	2	17
β-strand	768-769	2	15
β-strand	776-777	2	16
β-strand	782-785	4	15
β-strand	789-790	2	19
β-strand	793-794	2	19
β-strand	798-804	7	20
β-strand	815-819	5	20
α-helix	820-824	5
β-strand	830-841	12	18
β-strand	849	1	21
β-strand	865	1	22
β-strand	870	1	23
β-strand	871	1	22
α-helix	872	1
β-strand	876-877	2	18
β-strand	882-884	3	23
β-strand	887-889	3	21
α-helix	897-906	10
α-helix	908-911	4
β-strand	913-915	3	21
β-strand	918-919	2	23
α-helix	920-921	2
β-strand	926-935	10	18
α-helix	943-980	38
α-helix	989-991	3
α-helix	994-999	6
α-helix	1011-1036	26
α-helix	1042-1043	2
β-strand	1046-1058	13	18
β-strand	1065-1067	3	20
β-strand	1073-1080	8	20
α-helix	1082-1084	3
β-strand	1087	1	24
α-helix	1092	1
β-strand	1093	1	24
α-helix	1094	1
β-strand	1096-1098	3	20
α-helix	1100-1102	3
α-helix	1110-1133	24
α-helix	1138-1150	13
α-helix	1161-1163	3
α-helix	1168-1175	8
β-strand	1182-1183	2	1
α-helix	1192-1201	10
β-strand	1209-1210	2	20
β-strand	1213	1	24
α-helix	1219	1
β-strand	1220	1	24
α-helix	1221	1
β-strand	1225-1234	10	20
β-strand	1235	1	14
α-helix	1239-1241	3
β-strand	1244-1246	3	25
β-strand	1251	1	26
β-strand	1252	1	27
β-strand	1258	1	26
α-helix	1267	1
β-strand	1268-1270	3	28
α-helix	1272-1281	10
α-helix	1284-1291	8
α-helix	1298-1310	13
α-helix	1321-1332	12
β-strand	1335-1340	6	29

Chain J: 73 helices, 84 β-strands

Element	Residues	Length	Sheet
β-strand	19-24	6	29
α-helix	27-33	7
β-strand	34-37	4	40
β-strand	44	1	41
α-helix	50	1
β-strand	51	1	41
α-helix	52	1
α-helix	59-62	4
α-helix	78-80	3
α-helix	83	1
β-strand	84	1	42
α-helix	85	1
β-strand	91	1	42
α-helix	95-99	5
β-strand	102-112	11	40
α-helix	115-118	4
α-helix	122	1
α-helix	123-128	6
α-helix	132-139	8
β-strand	144-148	5	43
α-helix	154-155	2
β-strand	159-160	2	43
α-helix	162-171	10
β-strand	177-179	3	43
α-helix	181-191	11
α-helix	194-205	12
α-helix	211-229	19
α-helix	234-237	4
β-strand	238-244	7	40
α-helix	247-249	3
β-strand	252-254	3	44
β-strand	260-262	3	44
α-helix	265-285	21
α-helix	289-307	19
α-helix	315-316	2
β-strand	317	1	45
β-strand	323	1	45
α-helix	324-325	2
α-helix	327-331	5
α-helix	337	1
α-helix	338-342	5
β-strand	345-347	3	28
β-strand	350-354	5	25
β-strand	355-357	3	46
β-strand	365-369	5	46
α-helix	370-376	7
α-helix	378-387	10
α-helix	394-403	10
α-helix	406-415	10
β-strand	421-424	4	25
α-helix	431-433	3
β-strand	434-437	4	25
β-strand	438-442	5	46
β-strand	447-449	3	46
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	25
α-helix	474-482	9
β-strand	485	1	25
α-helix	486-488	3
β-strand	491	1	47
β-strand	498	1	47
α-helix	505-513	9
β-strand	526-527	2	48
α-helix	530-538	9
β-strand	547-557	11	48
β-strand	563-573	11	48
α-helix	574-579	6
α-helix	580-582	3
α-helix	584	1
α-helix	589-591	3
α-helix	598-612	15
α-helix	614-635	22
α-helix	645-647	3
α-helix	650-670	21
α-helix	675-701	27
β-strand	703-707	5	49
β-strand	713-717	5	49
α-helix	721-728	8
β-strand	745	1	50
β-strand	748	1	51
α-helix	753	1
β-strand	754	1	51
α-helix	755	1
β-strand	759	1	50
α-helix	769-804	36
β-strand	809-811	3	52
β-strand	820-822	3	53
β-strand	825-826	2	54
β-strand	828	1	55
β-strand	831-833	3	54
α-helix	836-839	4
β-strand	843	1	56
β-strand	844	1	53
β-strand	848-849	2	57
β-strand	856-858	3	57
β-strand	863	1	56
α-helix	866-875	10
β-strand	880-882	3	53
α-helix	885-887	3
β-strand	894-895	2	52
α-helix	896-899	4
β-strand	901	1	58
β-strand	908	1	58
α-helix	909-910	2
α-helix	915-924	10
α-helix	925-928	4
β-strand	949-952	4	59
β-strand	956	1	60
β-strand	957-961	5	55
β-strand	965-967	3	59
β-strand	973-975	3	59
β-strand	981-985	5	55
β-strand	991-996	6	55
β-strand	1002-1003	2	59
β-strand	1011	1	60
β-strand	1015-1019	5	59
β-strand	1025-1028	4	61
β-strand	1033	1	62
β-strand	1034-1038	5	63
β-strand	1042	1	61
β-strand	1046-1051	6	61
β-strand	1056-1061	6	61
α-helix	1062-1063	2
α-helix	1069-1073	5
β-strand	1077-1081	5	63
β-strand	1087	1	63
β-strand	1089	1	64
α-helix	1090	1
β-strand	1096	1	64
β-strand	1098-1100	3	63
β-strand	1105-1107	3	61
β-strand	1115	1	62
β-strand	1120-1124	5	61
α-helix	1138-1145	8
α-helix	1148-1150	3
β-strand	1156	1	65
β-strand	1161-1165	5	66
β-strand	1172-1178	7	66
β-strand	1186-1191	6	66
β-strand	1203-1204	2	66
β-strand	1209	1	65
α-helix	1214-1216	3
α-helix	1217-1223	7
α-helix	1226-1242	17
α-helix	1250-1260	11
β-strand	1263-1268	6	67
β-strand	1279-1281	3	67
α-helix	1282-1294	13
β-strand	1301-1304	4	67
α-helix	1309-1314	6
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1342	2	29
α-helix	1347-1352	6
α-helix	1360-1362	3
α-helix	1363-1373	11

Chain K: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-13	7
α-helix	16-31	16
α-helix	46-56	11
α-helix	61-77	17

Chain L: 32 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	97-105	9
α-helix	109-111	3
α-helix	113-135	23
α-helix	138-152	15
α-helix	158-161	4
α-helix	215-233	19
α-helix	245-258	14
α-helix	263-295	33
α-helix	299-306	8
α-helix	313-318	6
α-helix	319-321	3
α-helix	325-329	5
α-helix	334-351	18
α-helix	355-381	27
α-helix	384-392	9
α-helix	401-418	18
α-helix	421-423	3
α-helix	427-446	20
α-helix	454-474	21
α-helix	477-479	3
α-helix	480-487	8
α-helix	491-498	8
α-helix	503-504	2
β-strand	505-506	2	44
α-helix	509	1
β-strand	510	1	68
α-helix	511	1
β-strand	518	1	68
α-helix	519-522	4
β-strand	524	1	27
α-helix	528-530	3
α-helix	531-548	18
α-helix	553-563	11
α-helix	573-580	8
α-helix	584-599	16
α-helix	607-610	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800 (AlphaFold model)
T7A1 promoter fragment non-template strand	P	DNA	97	Escherichia phage T7
Nascent RNA	R	RNA	2	Escherichia coli
DNA-directed RNA polymerase subunit alpha	G, H	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1415	Escherichia coli	P0A8T7 (AlphaFold model)
RNA polymerase sigma factor RpoD	L	protein	616	Escherichia coli	P00579
T7A1 promoter fragment template strand	Q	DNA	97	Escherichia phage T7

Sequence of entity 1 (I), FASTA

>9YMV_1 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 2 (K), FASTA

>9YMV_2 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 3 (P), FASTA

>9YMV_3 T7A1 promoter fragment non-template strand (chains P)
GCTTAATTTAAAATTTATCAAAAAGAGTATTGACTTAAAGTCTAACCTATAGGATACTTA
CAGCCATCGAGAGGGACACGGCGAATAGCCATCCCGG

Sequence of entity 4 (R), FASTA

>9YMV_4 Nascent RNA (chains R)
UC

Sequence of entity 5 (G, H), FASTA

>9YMV_5 DNA-directed RNA polymerase subunit alpha (chains G, H)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 6 (J), FASTA

>9YMV_6 DNA-directed RNA polymerase subunit beta' (chains J)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNELELEVLFQ

Sequence of entity 7 (L), FASTA

>9YMV_7 RNA polymerase sigma factor RpoD (chains L)
SEFMEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVME
EAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEI
DIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPT
ATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKA
KGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKM
PKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQ
VKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVD
KFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGRE
PTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATT
ESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRK
LRHPSRSEVLRSFLDD

Sequence of entity 8 (Q), FASTA

>9YMV_8 T7A1 promoter fragment template strand (chains Q)
CCGGGATGGCTATTCGCCGTGTCCCTCTCGATGGCTGTAAGTATCCTATAGGTTAGACTT
TAAGTCAATACTCTTTTTGATAAATTTTAAATTAAGC

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
ZN	Zinc ion	Zn	2
MG	Magnesium ion	Mg	1
POP	Pyrophosphate 2-	H2 O7 P2	1

Primary citation

Structural basis for multi-subunit DNA-dependent RNA polymerase catalytic activity. Mueller, A.U., Darst, S.A. Mol Cell (2026) 86:1881. DOI 10.1016/j.molcel.2026.03.033 · PubMed

Other PDB entries of the same protein (UniProt P0A8V2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LTI 1.6 Å, Crystal structure of the Escherichia coli RNA polymerase beta subunit beta2-betai4 domains
7EGS 1.7 Å, The crystal structure of lobe domain of E. coli RNA polymerase complexed with the…
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 9YMV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.