3LUO: Peptidyl-prolyl cis-trans isomerase

Name: PDB 3LUO: Crystal Structure and functional characterization of the thermophilic prolyl isomerase and chaperone SlyD
Published: 2010-03-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

Crystal Structure and functional characterization of the thermophilic prolyl isomerase and chaperone SlyD. Determined by X-ray diffraction at 2.55 Å resolution. Released 31 Mar 2010.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Thermus thermophilus
Chains: 2
Atoms: 1,185
Mol. weight: 18.25 kDa
Ligands: ZN
Released: 31 Mar 2010

Explore 3LUO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LUO contains 8 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	7-17	11	2
β-strand	20-30	11	2
β-strand	36	1	3
α-helix	38-44	7
α-helix	47	1
β-strand	48	1	1
β-strand	52-57	6	2
α-helix	59-61	3
α-helix	68-70	3
β-strand	71-75	5	4
α-helix	76-78	3
β-strand	89-91	3	4
α-helix	93-95	3
β-strand	103-109	7	4
β-strand	112-116	5	4
β-strand	126-137	12	2
α-helix	138-139	2
α-helix	140-145	6

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase	A	protein	158	Thermus thermophilus	Q5SLE7 (AlphaFold model)
Suc-Ala-Leu-Pro-Phe-pNA	B	protein	6

Sequence of entity 1 (A), FASTA

>3LUO_1 Peptidyl-prolyl cis-trans isomerase (chains A)
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAE
KAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP
LAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH

Sequence of entity 2 (B), FASTA

>3LUO_2 Suc-Ala-Leu-Pro-Phe-pNA (chains B)
XALPAX

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus. Loew, C., Neumann, P., Tidow, H. et al. J Mol Biol (2010) 398:375-390. DOI 10.1016/j.jmb.2010.03.014 · PubMed

Other PDB entries of the same protein (UniProt Q5SLE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ODK 1.4 Å, Structure of SlyD from Thermus thermophilus in complex with T1 peptide
4ODN 1.6 Å, Structure of SlyD from Thermus thermophilus in complex with S2-plus peptide
4ODO 1.6 Å, Structure of SlyD from Thermus thermophilus in complex with FK506
7OXH 1.7 Å, ttSlyD with pseudo-wild-type S2 peptide
4ODP 1.75 Å, Structure of SlyD delta-IF from Thermus thermophilus in complex with S2-W23A peptide
4ODM 1.75 Å, Structure of SlyD from Thermus thermophilus in complex with S2-W23A peptide
7OXJ 1.85 Å, ttSlyD with M8A pseudo-wild-type S2 peptide
4ODR 1.93 Å, Structure of SlyD delta-IF from Thermus thermophilus in complex with FK506
4ODQ 2.0 Å, Structure of SlyD delta-IF from Thermus thermophilus in complex with S3 peptide
7OXG 2.0 Å, ttSlyD FKBP domain with M8A pseudo-wild-type S2 peptide
3CGM 2.41 Å, Crystal structure of thermophilic SlyD
7OXI 2.6 Å, ttSlyD with W4A pseudo-wild-type S2 peptide

Browse structure collections

About this viewer

MolViewer shows 3LUO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.