7OXI: TtSlyD with W4A pseudo-wild-type S2 peptide

ttSlyD with W4A pseudo-wild-type S2 peptide. Determined by X-ray diffraction at 2.6 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8), Escherichia coli (strain K12)
Chains: 3
Atoms: 1,362
Mol. weight: 20.76 kDa
Released: 16 Mar 2022

Explore 7OXI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OXI contains 9 α-helices and 13 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	7-17	11	2
β-strand	20-30	11	2
β-strand	36	1	3
α-helix	38-44	7
α-helix	47	1
β-strand	48	1	1
β-strand	52-57	6	2
α-helix	59-61	3
α-helix	65-67	3
α-helix	68-70	3
β-strand	71-75	5	4
α-helix	76-78	3
β-strand	90-94	5	4
β-strand	100-109	10	4
β-strand	112-116	5	4
β-strand	126-137	12	2
α-helix	138-139	2
α-helix	140-145	6

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	4-7	4
β-strand	9	1	3

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	9	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase	A	protein	158	Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)	Q5SLE7 (AlphaFold model)
30S ribosomal protein S2	B, C	protein	15	Escherichia coli (strain K12)	P0A7V0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7OXI_1 Peptidyl-prolyl cis-trans isomerase (chains A)
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAE
KAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP
LAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH

Sequence of entity 2 (B, C), FASTA

>7OXI_2 30S ribosomal protein S2 (chains B, C)
TRYANAKMLPFAFGA

Primary citation

Impact of distant peptide substrate residues on enzymatic activity of SlyD. Pazicky, S., Werle, A.A., Lei, J. et al. Cell Mol Life Sci (2022) 79:138-138. DOI 10.1007/s00018-022-04179-4 · PubMed

Other PDB entries of the same protein (UniProt Q5SLE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ODK 1.4 Å, Structure of SlyD from Thermus thermophilus in complex with T1 peptide
4ODN 1.6 Å, Structure of SlyD from Thermus thermophilus in complex with S2-plus peptide
4ODO 1.6 Å, Structure of SlyD from Thermus thermophilus in complex with FK506
7OXH 1.7 Å, ttSlyD with pseudo-wild-type S2 peptide
4ODP 1.75 Å, Structure of SlyD delta-IF from Thermus thermophilus in complex with S2-W23A peptide
4ODM 1.75 Å, Structure of SlyD from Thermus thermophilus in complex with S2-W23A peptide
7OXJ 1.85 Å, ttSlyD with M8A pseudo-wild-type S2 peptide
4ODR 1.93 Å, Structure of SlyD delta-IF from Thermus thermophilus in complex with FK506
4ODQ 2.0 Å, Structure of SlyD delta-IF from Thermus thermophilus in complex with S3 peptide
7OXG 2.0 Å, ttSlyD FKBP domain with M8A pseudo-wild-type S2 peptide
3CGM 2.41 Å, Crystal structure of thermophilic SlyD
3LUO 2.55 Å, Crystal Structure and functional characterization of the thermophilic prolyl isomerase…

Browse structure collections

About this viewer

MolViewer shows 7OXI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.