3LXJ: Bromodomain of Human AAA domain containing 2B

Crystal Structure of the Bromodomain of Human AAA domain containing 2B (ATAD2B). Determined by X-ray diffraction at 2.33 Å resolution. Released 9 Mar 2010.

Method: X-ray diffraction
Resolution: 2.33 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,424
Mol. weight: 63.64 kDa
Ligands: IPA
Released: 9 Mar 2010

Explore 3LXJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LXJ contains 32 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	952-975	24
α-helix	978-980	3
α-helix	986-988	3
α-helix	995-998	4
α-helix	1005-1013	9
α-helix	1020-1037	18
α-helix	1043-1066	24
α-helix	1069-1083	15

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	952-975	24
α-helix	978-983	6
α-helix	995-998	4
α-helix	1005-1013	9
α-helix	1020-1037	18
α-helix	1043-1066	24
α-helix	1069-1084	16

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	953-975	23
α-helix	978-983	6
α-helix	986-988	3
α-helix	990-992	3
α-helix	995-997	3
α-helix	1005-1013	9
α-helix	1020-1037	18
α-helix	1043-1066	24
α-helix	1069-1083	15

Chain D: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	955-975	21
α-helix	978-983	6
α-helix	986-988	3
α-helix	992-998	7
α-helix	1005-1013	9
α-helix	1020-1037	18
α-helix	1043-1066	24
α-helix	1069-1083	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATPase family AAA domain-containing protein 2B	A, B, C, D	protein	136	Homo sapiens	Q9ULI0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3LXJ_1 ATPase family AAA domain-containing protein 2B (chains A, B, C, D)
SMEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVIT
KIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPE
FNKLCEEIKEARIKRG

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	5

Primary citation

Histone recognition and large-scale structural analysis of the human bromodomain family. Filippakopoulos, P., Picaud, S., Mangos, M. et al. Cell (2012) 149:214-231. DOI 10.1016/j.cell.2012.02.013 · PubMed

Other PDB entries of the same protein (UniProt Q9ULI0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UK5 1.4 Å, Crystal structure of the bromodomain of human ATAD2B in complex with histone H4S1(ph)K5ac
8UHL 1.92 Å, ATAD2B bromodomain in complex with histone H4 acetylated at lysine 12
6VEO 2.4 Å, ATAD2B bromodomain in complex with 4-({[(3R,4R)-4-{[3-methyl-5-(5-methylpyridin-3-yl)-2-o…
8SDX 2.69 Å, ATAD2B bromodomain in complex with histone H4 acetylated at lysine 5 with Serine 1…
2DKW Solution structure of the bromodomain of human protein KIAA1240

Browse structure collections

About this viewer

MolViewer shows 3LXJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.