3M06: TRAF2

Crystal Structure of TRAF2. Determined by X-ray diffraction at 2.67 Å resolution. Released 28 Apr 2010.

Method: X-ray diffraction
Resolution: 2.67 Å
Organism: Homo sapiens
Chains: 6
Atoms: 2,686
Mol. weight: 50.41 kDa
Released: 28 Apr 2010

Explore 3M06 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3M06 contains 9 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	268-326	59

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	268-306	39
α-helix	313-316	4
α-helix	318-324	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	268-327	60

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	268-324	57

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	268-295	28
α-helix	299-325	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 2	A, B, C, D, E, F	protein	72	Homo sapiens	Q12933 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>3M06_1 TNF receptor-associated factor 2 (chains A, B, C, D, E, F)
SELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLE
RSIGLEHHHHHH

Primary citation

Crystal structures of the TRAF2: cIAP2 and the TRAF1: TRAF2: cIAP2 complexes: affinity, specificity, and regulation. Zheng, C., Kabaleeswaran, V., Wang, Y. et al. Mol Cell (2010) 38:101-113. DOI 10.1016/j.molcel.2010.03.009 · PubMed

Other PDB entries of the same protein (UniProt Q12933 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KNV 1.9 Å, Crystal structure of the RING and first zinc finger domains of TRAF2
8T5Q 1.9 Å, SARS-CoV-2 ORF3a peptide in complex with TRAF2 TRAF domain
1CZY 2.0 Å, Crystal structure of the complex between the traf domain of human TRAF2 and an LMP1…
1D00 2.0 Å, Structure of tnf receptor associated factor 2 in complex with a 5-residue CD40 peptide
1D01 2.0 Å, Structure of tnf receptor associated factor 2 in complex with a human CD30 peptide
1D0A 2.0 Å, Structure of tnf receptor associated factor 2 (TRAF2) in complex with a human OX40 peptide
1F3V 2.0 Å, Crystal structure of the complex between the N-terminal domain of TRADD and the TRAF…
1CA4 2.2 Å, Structure of tnf receptor associated factor 2 (TRAF2)
1CA9 2.3 Å, Structure of tnf receptor associated factor 2 in complex with a peptide from tnf-R2
1QSC 2.4 Å, Crystal structure of the traf domain of TRAF2 in a complex with a peptide from the CD40…
1D0J 2.5 Å, Structure of tnf receptor associated factor 2 in complex with a M4-1BB peptide
3M0A 2.61 Å, Crystal structure of TRAF2:cIAP2 complex

Browse structure collections

About this viewer

MolViewer shows 3M06 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.