3M3F: PEPA

PEPA bound to the ligand binding domain of GluA3 (flop form). Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Mar 2010.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 2,232
Mol. weight: 29.65 kDa
Ligands: ZN, P99, GLU
Released: 23 Mar 2010

Explore 3M3F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3M3F contains 12 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	13	1	2
β-strand	17	1	2
β-strand	18-19	2	3
α-helix	28-31	4
β-strand	32-33	2	3
α-helix	35-46	12
β-strand	50-55	6	1
β-strand	64	1	4
β-strand	71	1	4
α-helix	73-79	7
β-strand	85-86	2	1
β-strand	91	1	5
α-helix	94-97	4
β-strand	100-102	3	1
β-strand	107-109	3	5
β-strand	111-116	6	6
α-helix	124-128	5
β-strand	134-138	5	6
α-helix	142-149	8
α-helix	153-164	12
β-strand	170-171	2	6
α-helix	174-183	10
β-strand	188-193	6	6
α-helix	194-201	8
β-strand	208-210	3	6
β-strand	218-220	3	5
β-strand	223-225	3	1
α-helix	230-244	15
α-helix	246-251	6
α-helix	252-257	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor 3	A	protein	258	Rattus norvegicus	P19492 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3M3F_1 Glutamate receptor 3 (chains A)
RTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGA
RDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES
AEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRK
SKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNLAVLKLNE
QGLLDKLKNKWWYDKGEC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
P99	2-[2,6-difluoro-4-({2-[(phenylsulfonyl)amino]ethyl}sulfanyl)phenoxy]acetamide	C16 H16 F2 N2 O4 S2	1
GLU	Glutamic acid	C5 H9 N O4	1

Primary citation

Molecular mechanism of flop selectivity and subsite recognition for an AMPA receptor allosteric modulator: structures of GluA2 and GluA3 in complexes with PEPA. Ahmed, A.H., Ptak, C.P., Oswald, R.E. Biochemistry (2010) 49:2843-2850. DOI 10.1021/bi1000678 · PubMed

Other PDB entries of the same protein (UniProt P19492 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4F29 1.75 Å, Quisqualate bound to the ligand binding domain of GluA3i
3LSW 1.75 Å, Aniracetam bound to the ligand binding domain of GluA3
4F1Y 1.79 Å, CNQX bound to the ligand binding domain of GluA3
3M3K 1.79 Å, Ligand binding domain (S1S2) of GluA3 (flop)
4F3B 1.82 Å, Glutamate bound to the D655A mutant of the ligand binding domain of GluA3
4F39 1.83 Å, Kainate bound to the ligand binding domain of GluA3
3DLN 1.91 Å, Crystal structure of the binding domain of the AMPA subunit GluR3 bound to glutamate
4F2O 1.91 Å, Quisqualate bound to the D655A mutant of the ligand binding domain of GluA3
6FPJ 1.96 Å, Structure of the AMPAR GluA3 N-terminal domain bound to phosphate
3LSX 2.01 Å, Piracetam bound to the ligand binding domain of GluA3
4F22 2.06 Å, Kainate bound to the K660A mutant of the ligand binding domain of GluA3
4F3G 2.06 Å, Kainate bound to the ligand binding domain of GluA3i

Browse structure collections

About this viewer

MolViewer shows 3M3F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.