3MEA: SGF29

Crystal structure of the SGF29 in complex with H3K4me3. Determined by X-ray diffraction at 1.26 Å resolution. Released 28 Apr 2010.

Method: X-ray diffraction
Resolution: 1.26 Å
Organisms: Homo sapiens, Xenopus laevis
Chains: 2
Atoms: 1,474
Mol. weight: 21.74 kDa
Released: 28 Apr 2010

Explore 3MEA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MEA contains 12 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	129-131	3
β-strand	132	1	1
α-helix	133	1
α-helix	135-136	2
α-helix	139-142	4
β-strand	145	1	2
α-helix	148-151	4
α-helix	156-157	2
β-strand	161-167	7	3
β-strand	173-184	12	3
β-strand	189-194	6	3
β-strand	201-206	6	3
α-helix	207-209	3
β-strand	210-212	3	3
α-helix	213-214	2
β-strand	216	1	2
β-strand	217	1	1
α-helix	224-226	3
β-strand	233-237	5	3
α-helix	238	1
β-strand	243-251	9	3
β-strand	260-264	5	3
β-strand	265	1	4
β-strand	273	1	4
α-helix	274-276	3
β-strand	277-279	3	3
α-helix	281-283	3
β-strand	284-286	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SAGA-associated factor 29 homolog	A	protein	180	Homo sapiens	Q96ES7 (AlphaFold model)
Histone H3	B	protein	11	Xenopus laevis	Q92133 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MEA_1 SAGA-associated factor 29 homolog (chains A)
MHHHHHHSSRENLYFQGTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDG
DEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKE
QLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKEPK

Sequence of entity 2 (B), FASTA

>3MEA_2 Histone H3 (chains B)
ARTKQTARKST

Primary citation

Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation. Bian, C., Xu, C., Ruan, J. et al. EMBO J (2011) 30:2829-2842. DOI 10.1038/emboj.2011.193 · PubMed

Other PDB entries of the same protein (UniProt Q96ES7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MEU 1.28 Å, Crystal structure of SGF29 in complex with H3R2me2sK4me3
3ME9 1.37 Å, Crystal structure of SGF29 in complex with H3K4me3 peptide
5C0M 1.6 Å, Crystal structure of SGF29 tandem tudor domain in complex with a Carba containing peptide
3LX7 1.78 Å, Crystal structure of a Novel Tudor domain-containing protein SGF29
3MEV 1.83 Å, Crystal structure of SGF29 in complex with R2AK4me3
3MEW 1.92 Å, Crystal structure of Novel Tudor domain-containing protein SGF29
3MET 2.0 Å, Crystal structure of SGF29 in complex with H3K4me2

Browse structure collections

About this viewer

MolViewer shows 3MEA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.