3MP6: Complex Structure of Sgf29 and dimethylated H3K4

Complex Structure of Sgf29 and dimethylated H3K4. Determined by X-ray diffraction at 1.48 Å resolution. Released 4 May 2011.

Method: X-ray diffraction
Resolution: 1.48 Å
Organisms: Escherichia coli K-12, unidentified, Saccharomyces cerevisiae S288c
Chains: 2
Atoms: 4,794
Mol. weight: 58.37 kDa
Released: 4 May 2011

Explore 3MP6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MP6 contains 31 α-helices and 38 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	745-748	4	1
α-helix	755-769	15
β-strand	773-776	4	1
α-helix	781-790	10
β-strand	797-801	5	1
α-helix	802-804	3
α-helix	805-810	6
β-strand	814	1	2
α-helix	815-817	3
α-helix	821-825	5
β-strand	827	1	3
α-helix	829-834	6
β-strand	836-837	2	4
β-strand	840-841	2	4
β-strand	844-849	6	1
β-strand	852-856	5	5
β-strand	866	1	6
α-helix	867-869	3
α-helix	870-878	9
β-strand	883-885	3	5
α-helix	892-894	3
α-helix	896-901	6
β-strand	905-910	6	7
β-strand	913-920	8	7
α-helix	924-938	15
α-helix	948-956	9
β-strand	960-965	6	5
α-helix	967-969	3
α-helix	970-976	7
β-strand	980-983	4	5
α-helix	984-986	3
β-strand	987	1	6
β-strand	988	1	8
β-strand	991	1	8
α-helix	995	1
β-strand	996-997	2	9
β-strand	998-1004	7	1
β-strand	1005	1	2
α-helix	1011-1016	6
α-helix	1017-1022	6
α-helix	1025-1034	10
β-strand	1039-1040	2	1
β-strand	1042	1	3
α-helix	1043-1049	7
α-helix	1053-1064	12
β-strand	1066-1067	2	9
α-helix	1068-1069	2
α-helix	1074-1090	17
α-helix	1095-1105	11
β-strand	1111	1	10
β-strand	1125	1	10
β-strand	1130-1133	4	11
β-strand	1144-1153	10	11
β-strand	1158-1163	6	11
β-strand	1167	1	12
β-strand	1170	1	12
β-strand	1174-1178	5	11
α-helix	1180-1182	3
β-strand	1183-1186	4	11
α-helix	1194-1196	3
β-strand	1200-1204	5	11
α-helix	1205	1
β-strand	1210-1219	10	11
α-helix	1224	1
β-strand	1225-1229	5	11
β-strand	1239-1241	3	11
α-helix	1243-1245	3
β-strand	1246-1248	3	11
α-helix	1250-1253	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein,LINKER,SAGA-associated factor 29	A	protein	522	Escherichia coli K-12, unidentified, Saccharomyces cerevisiae S288c	P0AEX9 (AlphaFold model), P25554 (AlphaFold model)
H3K4me2 peptide	P	protein	4	synthetic construct	P61830 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MP6_1 Maltose-binding periplasmic protein,LINKER,SAGA-associated factor 29 (chains A)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSK
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDE
ALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGSADGEWIQCEVLKVVADGT
RFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVI
GTKRDGTCRLRFDGEEEVDKETEVTRRLVLPSPTALANLARK

Sequence of entity 2 (P), FASTA

>3MP6_2 H3K4me2 peptide (chains P)
ARTK

Primary citation

Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation. Bian, C., Xu, C., Ruan, J. et al. EMBO J (2011) 30:2829-2842. DOI 10.1038/emboj.2011.193 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan
3O3U 1.5 Å, Crystal Structure of Human Receptor for Advanced Glycation Endproducts (RAGE)

Browse structure collections

About this viewer

MolViewer shows 3MP6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.