3MQM: Bromodomain of human ASH1L

Crystal Structure of the Bromodomain of human ASH1L. Determined by X-ray diffraction at 2.54 Å resolution. Released 19 May 2010.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,933
Mol. weight: 28.75 kDa
Released: 19 May 2010

Explore 3MQM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MQM contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2433-2453	21
β-strand	2455	1	1
β-strand	2461	1	1
α-helix	2464-2466	3
α-helix	2469-2471	3
α-helix	2472-2474	3
α-helix	2478-2481	4
α-helix	2488-2497	10
α-helix	2503-2521	19
α-helix	2526-2553	28

Chain B: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2433-2453	21
β-strand	2455-2456	2	2
β-strand	2460-2461	2	2
α-helix	2464-2466	3
α-helix	2469-2471	3
α-helix	2472-2474	3
α-helix	2478-2481	4
α-helix	2488-2497	10
α-helix	2503-2521	19
α-helix	2526-2553	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable histone-lysine N-methyltransferase ASH1L	A, B	protein	126	Homo sapiens	Q9NR48

Sequence of entity 1 (A, B), FASTA

>3MQM_1 Probable histone-lysine N-methyltransferase ASH1L (chains A, B)
SMEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLIT
IEKQILTGYYKTVEAFDADMLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARHEASAQID
EIVGET

Primary citation

Histone recognition and large-scale structural analysis of the human bromodomain family. Filippakopoulos, P., Picaud, S., Mangos, M. et al. Cell (2012) 149:214-231. DOI 10.1016/j.cell.2012.02.013 · PubMed

Other PDB entries of the same protein (UniProt Q9NR48), best resolution first:

8VLF 1.34 Å, Crystal structure of Ash1L PHD finger in complex with histone H3K4me3
6WZW 1.69 Å, Ash1L SET domain in complex with AS-85
6X0P 1.69 Å, Ash1L SET domain Q2265A mutant in complex with AS-5
8VLD 1.92 Å, Crystal structure of Ash1L PHD finger in complex with histone H3K4me2
4YNM 2.19 Å, ASH1L wild-type SET domain in complex with S-adenosyl methionine (SAM)
4YPE 2.2 Å, ASH1L SET domain H2193F mutant in complex with S-adenosyl methionine (SAM)
4YPA 2.3 Å, ASH1L SET domain Q2265A mutant in complex with S-adenosyl methionine (SAM)
8VLH 2.4 Å, Crystal structure of Ash1L PHD-BAH domains
4YPU 2.6 Å, ASH1L SET domain K2264L mutant in complex with S-adenosyl methionine (SAM)
6INE 2.6 Å, Crystal Structure of human ASH1L-MRG15 complex
3OPE 2.9 Å, Structural Basis of Auto-inhibitory mechanism of Histone methyltransferase
4YNP 2.9 Å, ASH1L SET domain S2259M mutant in complex with S-adenosyl methionine (SAM)

Browse structure collections

About this viewer

MolViewer shows 3MQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.