8VLD: Ash1L PHD finger

Crystal structure of Ash1L PHD finger in complex with histone H3K4me2. Determined by X-ray diffraction at 1.92 Å resolution. Released 19 Mar 2025.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,032
Mol. weight: 15.76 kDa
Ligands: ZN
Released: 19 Mar 2025

Explore 8VLD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VLD contains 2 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
β-strand	18-21	4	1
β-strand	28-30	3	1
α-helix	31-34	4

Chains P and T: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-5	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase ASH1L	A, B	protein	56	Homo sapiens	Q9NR48
Histone H3.3C	P, T	protein	11	Homo sapiens	Q6NXT2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8VLD_1 Histone-lysine N-methyltransferase ASH1L (chains A, B)
GPLDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDRE

Sequence of entity 2 (P, T), FASTA

>8VLD_2 Histone H3.3C (chains P, T)
ARTKQTARKST

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structure-function relationship of ASH1L and histone H3K36 and H3K4 methylation. Vann, K.R., Sharma, R., Hsu, C.C. et al. Nat Commun (2025) 16:2235-2235. DOI 10.1038/s41467-025-57556-5 · PubMed

Other PDB entries of the same protein (UniProt Q9NR48), best resolution first:

8VLF 1.34 Å, Crystal structure of Ash1L PHD finger in complex with histone H3K4me3
6WZW 1.69 Å, Ash1L SET domain in complex with AS-85
6X0P 1.69 Å, Ash1L SET domain Q2265A mutant in complex with AS-5
4YNM 2.19 Å, ASH1L wild-type SET domain in complex with S-adenosyl methionine (SAM)
4YPE 2.2 Å, ASH1L SET domain H2193F mutant in complex with S-adenosyl methionine (SAM)
4YPA 2.3 Å, ASH1L SET domain Q2265A mutant in complex with S-adenosyl methionine (SAM)
8VLH 2.4 Å, Crystal structure of Ash1L PHD-BAH domains
3MQM 2.54 Å, Crystal Structure of the Bromodomain of human ASH1L
4YPU 2.6 Å, ASH1L SET domain K2264L mutant in complex with S-adenosyl methionine (SAM)
6INE 2.6 Å, Crystal Structure of human ASH1L-MRG15 complex
3OPE 2.9 Å, Structural Basis of Auto-inhibitory mechanism of Histone methyltransferase
4YNP 2.9 Å, ASH1L SET domain S2259M mutant in complex with S-adenosyl methionine (SAM)

Browse structure collections

About this viewer

MolViewer shows 8VLD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.