3MVD: Chromatin factor RCC1
Crystal structure of the chromatin factor RCC1 in complex with the nucleosome core particle. Determined by X-ray diffraction at 2.9 Å resolution. Released 25 Aug 2010.
- Method
- X-ray diffraction
- Resolution
- 2.9 Å
- Organisms
- Xenopus laevis, Drosophila melanogaster
- Chains
- 12
- Atoms
- 17,743
- Mol. weight
- 289.62 kDa
- Released
- 25 Aug 2010
Explore 3MVD in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3MVD contains 50 α-helices and 86 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and E: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-42 | 2 | |
| α-helix | 45-56 | 12 | |
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 1 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 2 |
| α-helix | 121-131 | 11 | |
Chain B: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-41 | 11 | |
| β-strand | 45-46 | 2 | 2 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 3 |
Chain C: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-20 | 4 | |
| α-helix | 27-35 | 9 | |
| β-strand | 42-43 | 2 | 4 |
| α-helix | 46-72 | 27 | |
| β-strand | 77-78 | 2 | 5 |
| α-helix | 80-89 | 10 | |
| α-helix | 91-96 | 6 | |
| β-strand | 100-102 | 3 | 6 |
| α-helix | 113-115 | 3 | |
Chain D: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-45 | 11 | |
| β-strand | 50-51 | 2 | 5 |
| α-helix | 53-80 | 28 | |
| β-strand | 85-86 | 2 | 4 |
| α-helix | 88-98 | 11 | |
| α-helix | 101-119 | 19 | |
Chain F: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 8 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 7 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 6 |
Chain G: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-20 | 4 | |
| α-helix | 27-35 | 9 | |
| β-strand | 42-43 | 2 | 9 |
| α-helix | 46-71 | 26 | |
| β-strand | 77-78 | 2 | 10 |
| α-helix | 80-88 | 9 | |
| α-helix | 91-96 | 6 | |
| β-strand | 100-102 | 3 | 3 |
| α-helix | 113-115 | 3 | |
Chain H: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-45 | 11 | |
| β-strand | 50-51 | 2 | 10 |
| α-helix | 53-80 | 28 | |
| β-strand | 85-86 | 2 | 9 |
| α-helix | 88-98 | 11 | |
| α-helix | 101-120 | 20 | |
Chain K: 6 helices, 32 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 32-38 | 7 | |
| β-strand | 42-49 | 8 | 11 |
| β-strand | 63-69 | 7 | 11 |
| α-helix | 70-71 | 2 | |
| β-strand | 76-81 | 6 | 11 |
| β-strand | 85-90 | 6 | 11 |
| β-strand | 95-99 | 5 | 11 |
| β-strand | 120-121 | 2 | 11 |
| β-strand | 128-133 | 6 | 12 |
| β-strand | 137-142 | 6 | 12 |
| β-strand | 147-151 | 5 | 12 |
| β-strand | 153-154 | 2 | 13 |
| β-strand | 159-161 | 3 | 13 |
| β-strand | 163 | 1 | 14 |
| β-strand | 166 | 1 | 14 |
| β-strand | 168-173 | 6 | 12 |
| β-strand | 180-185 | 6 | 15 |
| β-strand | 189-194 | 6 | 15 |
| β-strand | 199-203 | 5 | 15 |
| β-strand | 233-235 | 3 | 15 |
| α-helix | 241-242 | 2 | |
| β-strand | 243-249 | 7 | 16 |
| β-strand | 252-257 | 6 | 16 |
| α-helix | 262 | 1 | |
| β-strand | 263-268 | 6 | 16 |
| β-strand | 283-290 | 8 | 16 |
| β-strand | 295-300 | 6 | 17 |
| β-strand | 304-309 | 6 | 17 |
| β-strand | 314-318 | 5 | 17 |
| α-helix | 321-323 | 3 | |
| β-strand | 334-339 | 6 | 17 |
| α-helix | 346 | 1 | |
| β-strand | 347-353 | 7 | 18 |
| β-strand | 356-361 | 6 | 18 |
| β-strand | 366-370 | 5 | 18 |
| β-strand | 385-390 | 6 | 18 |
| β-strand | 401-406 | 6 | 11 |
| β-strand | 410-416 | 7 | 11 |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H3.2 | A, E | protein | 135 | Xenopus laevis | P84233 (AlphaFold model) |
| Histone H4 | B, F | protein | 102 | Xenopus laevis | P62799 (AlphaFold model) |
| Histone H2A | C, G | protein | 129 | Xenopus laevis | Q6AZJ8 (AlphaFold model) |
| Histone H2B 1.1 | D, H | protein | 122 | Xenopus laevis | P02281 (AlphaFold model) |
| DNA (146-mer) | I | DNA | 147 | | |
| DNA (146-mer) | J | DNA | 147 | | |
| Regulator of chromosome condensation | K, L | protein | 423 | Drosophila melanogaster | P25171 |
Sequence of entity 1 (A, E), FASTA
>3MVD_1 Histone H3.2 (chains A, E)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIM
PKDIQLARRIRGERA
Sequence of entity 2 (B, F), FASTA
>3MVD_2 Histone H4 (chains B, F)
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 3 (C, G), FASTA
>3MVD_3 Histone H2A (chains C, G)
SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
ESSKSAKSK
Sequence of entity 4 (D, H), FASTA
>3MVD_4 Histone H2B 1.1 (chains D, H)
AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMN
SFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
AK
Sequence of entity 5 (I), FASTA
>3MVD_5 DNA (146-MER) (chains I)
ATCGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAA
ACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCA
GGCACGTGTCAGATATATACATCCGAT
Sequence of entity 6 (J), FASTA
>3MVD_6 DNA (146-MER) (chains J)
ATCGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAA
AACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTG
AGCGGCCTCGGCACCGGGATTCTCGAT
Sequence of entity 7 (K, L), FASTA
>3MVD_7 Regulator of chromosome condensation (chains K, L)
GSPRRKALTNNNNAGEAEQQPPKAKRARIAFHLELPKRRTVLGNVLVCGNGDVGQLGLGE
DILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSESKP
DLIDLPGKALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLTIDGNKRTPIDLMEGTV
CCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITR
AKPFEAIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPIKTELKDIRHIA
GGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVKKLTEKIVSVGCGEVCSYA
VTIDGKLYSWGSGVNNQLGVGDGDDELEPIVVVSKNTQGKHMLLASGGGQHAIFLVKADK
QDQ
Primary citation
Structure of RCC1 chromatin factor bound to the nucleosome core particle. Makde, R.D., England, J.R., Yennawar, H.P. et al. Nature (2010) 467:562-566. DOI 10.1038/nature09321 · PubMed
Other PDB entries of the same protein (UniProt P84233 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2HUE 1.7 Å, Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4
- 3GV6 1.76 Å, Crystal Structure of human chromobox homolog 6 (CBX6) with H3K9 peptide
- 1KX5 1.94 Å, X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
- 1KX3 2.0 Å, X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution
- 4QEO 2.0 Å, crystal structure of KRYPTONITE in complex with mCHH DNA, H3(1-15) peptide and SAH
- 1S32 2.05 Å, Molecular Recognition of the Nucleosomal 'Supergroove'
- 3UTA 2.07 Å, Crystal Structure of Nucleosome Core Particle Assembled with an Alpha-Satellite Sequence…
- 3C1B 2.2 Å, The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin…
- 3UT9 2.2 Å, Crystal Structure of Nucleosome Core Particle Assembled with a Palindromic Widom '601'…
- 3UTB 2.2 Å, Crystal Structure of Nucleosome Core Particle Assembled with the 146b Alpha-Satellite…
- 6WZ5 2.2 Å, Bridging of double-strand DNA break activates PARP2/HPF1 to modify chromatin
- 8RUQ 2.29 Å, Borealin N-terminus in complex with H3.T3p-nucleosome
Browse structure collections
About this viewer
MolViewer shows 3MVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.