Crystal structure of auxilin (40-400). Determined by X-ray diffraction at 2.2 Å resolution. Released 22 Sept 2010.
Explore 3N0A in 3D Show helices and sheets RCSB PDB PDBe
3N0A contains 19 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 54-57 | 4 | 1 |
| β-strand | 62-65 | 4 | 1 |
| β-strand | 70-74 | 5 | 1 |
| α-helix | 89-99 | 11 | |
| β-strand | 103-107 | 5 | 1 |
| α-helix | 114-116 | 3 | |
| α-helix | 119-121 | 3 | |
| β-strand | 122-124 | 3 | 1 |
| α-helix | 132-134 | 3 | |
| α-helix | 135-151 | 17 | |
| β-strand | 156-161 | 6 | 1 |
| α-helix | 166-178 | 13 | |
| α-helix | 185-195 | 11 | |
| α-helix | 200-202 | 3 | |
| α-helix | 203-216 | 14 | |
| β-strand | 228-236 | 9 | 2 |
| β-strand | 247-248 | 2 | 3 |
| β-strand | 250-256 | 7 | 4 |
| β-strand | 259-263 | 5 | 4 |
| α-helix | 268-270 | 3 | |
| α-helix | 272-273 | 2 | |
| β-strand | 274-275 | 2 | 3 |
| α-helix | 276-278 | 3 | |
| β-strand | 281-289 | 9 | 2 |
| β-strand | 292-304 | 13 | 4 |
| β-strand | 310-323 | 14 | 4 |
| α-helix | 324-326 | 3 | |
| β-strand | 333-337 | 5 | 2 |
| α-helix | 338-340 | 3 | |
| β-strand | 342 | 1 | 4 |
| α-helix | 347-349 | 3 | |
| β-strand | 355-362 | 8 | 2 |
| α-helix | 366-369 | 4 | |
| α-helix | 374-377 | 4 | |
| α-helix | 385-388 | 4 | |
| α-helix | 392-398 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein phosphatase auxilin | A | protein | 361 | Bos taurus | Q27974 (AlphaFold model) |
>3N0A_1 Tyrosine-protein phosphatase auxilin (chains A) DTLKDTSSRVIQSVTSYTKGDLDFTYVTSRIIVMSFPLDSVDIGFRNQVDDIRSFLDSRH LDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVV HCLDGRAASSILVGAMFIFCNLYSTPGPAVRLLYAKRPGIGLSPSHRRYLGYMCDLLADK PYRPHFKPLTIKSITVSPVPFFNKQRNGCRPYCDVLIGETKIYTTCADFERMKEYRVQDG KIFIPLSITVQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKP ELDACDVPEKYPQLFQVTLDVELQPHDKVMELTPPWEHYCTKDVNPSILFSSHQEHQDTL V
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (CL) are not listed.
Structure of the PTEN-like Region of Auxilin, a Detector of Clathrin-Coated Vesicle Budding. Guan, R., Han, D., Harrison, S.C. et al. Structure (2010) 18:1191-1198. DOI 10.1016/j.str.2010.06.016 · PubMed
Other PDB entries of the same protein (UniProt Q27974 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3N0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.