Crystal structures of the mature envelope glycoprotein complex (furin cleavage) of Chikungunya virus. Determined by X-ray diffraction at 3.0 Å resolution. Released 1 Dec 2010.
Explore 3N42 in 3D Show helices and sheets RCSB PDB PDBe
3N42 contains 21 α-helices and 74 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 1 |
| β-strand | 15 | 1 | 1 |
| α-helix | 26-29 | 4 | |
| α-helix | 31-39 | 9 | |
| α-helix | 47-54 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-10 | 3 | |
| β-strand | 12 | 1 | 2 |
| β-strand | 17-19 | 3 | 3 |
| β-strand | 21 | 1 | 4 |
| β-strand | 28-30 | 3 | 3 |
| β-strand | 34-38 | 5 | 5 |
| β-strand | 46-56 | 11 | 5 |
| β-strand | 62-71 | 10 | 5 |
| β-strand | 74-79 | 6 | 5 |
| β-strand | 84-86 | 3 | 4 |
| β-strand | 90 | 1 | 4 |
| β-strand | 92-104 | 13 | 5 |
| β-strand | 108-116 | 9 | 4 |
| β-strand | 122-131 | 10 | 4 |
| α-helix | 133-135 | 3 | |
| β-strand | 139 | 1 | 6 |
| α-helix | 144-145 | 2 | |
| β-strand | 149-156 | 8 | 7 |
| β-strand | 166-170 | 5 | 8 |
| β-strand | 175-176 | 2 | 9 |
| α-helix | 178-180 | 3 | |
| β-strand | 181-182 | 2 | 10 |
| β-strand | 188-190 | 3 | 10 |
| β-strand | 197-201 | 5 | 9 |
| β-strand | 210-211 | 2 | 9 |
| β-strand | 215-217 | 3 | 10 |
| α-helix | 222-224 | 3 | |
| β-strand | 225-229 | 5 | 9 |
| β-strand | 235 | 1 | 2 |
| β-strand | 236-237 | 2 | 8 |
| α-helix | 243-245 | 3 | |
| β-strand | 253-256 | 4 | 8 |
| β-strand | 261-268 | 8 | 7 |
| α-helix | 271-274 | 4 | |
| β-strand | 275-279 | 5 | 11 |
| β-strand | 282-287 | 6 | 11 |
| β-strand | 293-299 | 7 | 6 |
| β-strand | 307-311 | 5 | 6 |
| β-strand | 315-320 | 6 | 11 |
| β-strand | 326-330 | 5 | 6 |
| α-helix | 334-335 | 2 | |
| β-strand | 336-338 | 3 | 6 |
| β-strand | 339-340 | 2 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 0-8 | 9 | 13 |
| β-strand | 15-19 | 5 | 14 |
| β-strand | 24 | 1 | 15 |
| β-strand | 27-48 | 22 | 14 |
| β-strand | 51-54 | 4 | 16 |
| β-strand | 59-61 | 3 | 17 |
| β-strand | 77-82 | 6 | 17 |
| β-strand | 87-88 | 2 | 18 |
| β-strand | 91-92 | 2 | 18 |
| β-strand | 101-106 | 6 | 17 |
| β-strand | 107-110 | 4 | 16 |
| α-helix | 112-115 | 4 | |
| β-strand | 119-137 | 19 | 14 |
| β-strand | 140-147 | 8 | 14 |
| β-strand | 153-156 | 4 | 13 |
| β-strand | 159-163 | 5 | 13 |
| β-strand | 176-180 | 5 | 14 |
| β-strand | 183-186 | 4 | 14 |
| α-helix | 195-196 | 2 | |
| β-strand | 203-205 | 3 | 14 |
| β-strand | 213-215 | 3 | 14 |
| β-strand | 220-221 | 2 | 19 |
| α-helix | 223-225 | 3 | |
| β-strand | 233-234 | 2 | 19 |
| α-helix | 239-243 | 5 | |
| α-helix | 251-254 | 4 | |
| α-helix | 256-258 | 3 | |
| β-strand | 260-262 | 3 | 14 |
| β-strand | 267-269 | 3 | 14 |
| β-strand | 275-283 | 9 | 13 |
| α-helix | 284-286 | 3 | |
| β-strand | 289 | 1 | 15 |
| α-helix | 294-295 | 2 | |
| β-strand | 296-305 | 10 | 20 |
| β-strand | 307 | 1 | 21 |
| β-strand | 314-322 | 9 | 20 |
| β-strand | 326-329 | 4 | 22 |
| β-strand | 330-332 | 3 | 23 |
| β-strand | 337-339 | 3 | 20 |
| β-strand | 343-346 | 4 | 22 |
| β-strand | 351-358 | 8 | 20 |
| β-strand | 362-369 | 8 | 23 |
| β-strand | 372-379 | 8 | 23 |
| α-helix | 380 | 1 | |
| β-strand | 381 | 1 | 21 |
| α-helix | 382-383 | 2 | |
| β-strand | 387-388 | 2 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 envelope glycoprotein | A | protein | 65 | Chikungunya virus | Q1H8W5 |
| E2 envelope glycoprotein | B | protein | 360 | Chikungunya virus | Q1H8W5 |
| E1 envelope glycoprotein | F | protein | 473 | Chikungunya virus | Q1H8W5 |
>3N42_1 E3 envelope glycoprotein (chains A) MSLAIPVMCLLANTTFPCSQPPCTPCCYEKEPEETLRMLEDNVMRPGYYQLLQASLTCSP HRQRR
>3N42_2 E2 envelope glycoprotein (chains B) STKDNFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDD SHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRK ISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTL MSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSP LVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNM GEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQLSTNGTAHGHPHEIILYYY
>3N42_3 E1 envelope glycoprotein (chains F) ELYGGGGSGGGGSGGGGSGGGGYEHVTVIPNTVGVPYKTLVNRPGYSPMVLEMELLSVTL EPTLSLDYITCEYKTVIPSPYVKCCGTAECKDKNLPDYSCKVFTGVYPFMWGGAYCFCDA ENTQLSEAHVEKSESCKTEFASAYRAHTASASAKLRVLYQGNNITVTAYANGDHAVTVKD AKFIVGPMSSAWTPFDNKIVVYKGDVYNMDYPPFGAGRPGQFGDIQSRTPESKDVYANTQ LVLQRPAAGTVHVPYSQAPSGFKYWLKERGASLQHTAPFGCQIATNPVRAVNCAVGNMPI SIDIPEAAFTRVVDAPSLTDMSCEVPACTHSSDFGGVAIIKYAASKKGKCAVHSMTNAVT IREAEIEVEGNSQLQISFSTALASAEFRVQVCSTQVHCAAECHPPKDHIVNYPASHTTLG VQDISATAMSWVQKGPFEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEK
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography. Voss, J.E., Vaney, M.C., Duquerroy, S. et al. Nature (2010) 468:709-712. DOI 10.1038/nature09555 · PubMed
Other PDB entries of the same protein (UniProt Q1H8W5), best resolution first:
MolViewer shows 3N42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.