9IW2: Chikungunya virus E protein

Chikungunya virus E protein complexed with C37 Fab. Determined by X-ray diffraction at 3.2 Å resolution. Released 30 Jul 2025.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Chikungunya virus, Homo sapiens
Chains: 4
Atoms: 9,007
Mol. weight: 146.42 kDa
Released: 30 Jul 2025

Explore 9IW2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9IW2 contains 34 α-helices and 116 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain F: 9 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	1-8	8	1
β-strand	11	1	2
β-strand	15-19	5	2
β-strand	24	1	3
β-strand	27-48	22	2
β-strand	51-54	4	4
β-strand	59-61	3	5
β-strand	77-82	6	5
β-strand	87-88	2	6
β-strand	91-92	2	6
β-strand	101-106	6	5
β-strand	107-110	4	4
α-helix	112-115	4
β-strand	119-136	18	2
β-strand	141-144	4	2
β-strand	153-156	4	1
β-strand	159-163	5	1
β-strand	176-180	5	2
β-strand	183-186	4	2
α-helix	189-191	3
β-strand	203-204	2	7
β-strand	205	1	2
β-strand	214-215	2	7
β-strand	220-221	2	8
α-helix	223-225	3
β-strand	233-234	2	8
α-helix	236-238	3
α-helix	239-246	8
α-helix	251-254	4
β-strand	260-262	3	2
β-strand	267-269	3	2
β-strand	275-282	8	1
α-helix	284-286	3
β-strand	289	1	3
α-helix	290-292	3
β-strand	300-302	3	9
β-strand	306	1	9
β-strand	314-321	8	9
β-strand	326-329	4	10
β-strand	330-332	3	11
β-strand	337-338	2	12
β-strand	343-346	4	10
β-strand	349-356	8	9
β-strand	357-358	2	12
β-strand	362-369	8	11
β-strand	372-379	8	11
α-helix	381-383	3
β-strand	387-388	2	13

Chain H: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	14
β-strand	11-12	2	15
β-strand	18-25	8	14
α-helix	29-32	4
β-strand	35-41	7	16
β-strand	48-54	7	16
β-strand	59-61	3	16
β-strand	69-74	6	14
β-strand	79-84	6	14
α-helix	89-91	3
β-strand	93-100	8	16
β-strand	110-111	2	16
β-strand	115-117	3	16
β-strand	118-119	2	15
α-helix	125-127	3
β-strand	128-132	5	17
α-helix	133-135	3
β-strand	143-153	11	17
β-strand	159-162	4	18
α-helix	163-165	3
β-strand	167	1	18
β-strand	171-173	3	17
α-helix	174-176	3
β-strand	177-178	2	17
β-strand	184-193	10	17
α-helix	194-196	3
β-strand	203-208	6	18
α-helix	209-211	3
β-strand	213-218	6	18

Chain L: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	19
β-strand	10-13	4	20
β-strand	19-25	7	19
β-strand	33-38	6	20
β-strand	45-49	5	20
β-strand	53-54	2	20
α-helix	55	1
β-strand	62-67	6	19
β-strand	70-75	6	19
α-helix	80-82	3
β-strand	85-90	6	20
β-strand	93-94	2	21
α-helix	97	1
β-strand	98-99	2	20
β-strand	103-107	5	20
α-helix	108	1
β-strand	112	1	22
α-helix	113-114	2
β-strand	115-119	5	23
α-helix	120-122	3
α-helix	123-126	4
β-strand	130-140	11	23
β-strand	141	1	22
β-strand	146-151	6	24
β-strand	155	1	24
β-strand	160-164	5	23
α-helix	165-168	4
β-strand	174-183	10	23
α-helix	184-189	6
β-strand	192-198	7	24
β-strand	206-211	6	24

Chain P: 8 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	71-73	3
β-strand	76	1	25
β-strand	81-83	3	26
β-strand	85	1	27
β-strand	92-94	3	26
β-strand	98-102	5	28
β-strand	110-120	11	28
β-strand	126-135	10	28
β-strand	138-143	6	28
α-helix	144-146	3
β-strand	148-149	2	27
β-strand	156-168	13	28
β-strand	172-180	9	27
β-strand	186-195	10	27
α-helix	198-199	2
β-strand	203	1	29
β-strand	213-220	8	30
β-strand	230-234	5	31
α-helix	235-238	4
β-strand	239-240	2	21
α-helix	242-244	3
β-strand	245-246	2	32
β-strand	252-254	3	32
β-strand	260-265	6	21
β-strand	272-275	4	21
β-strand	279-281	3	32
α-helix	286-288	3
β-strand	289-294	6	21
β-strand	299	1	25
β-strand	300-301	2	31
β-strand	317-320	4	31
β-strand	325-332	8	30
α-helix	335-338	4
β-strand	339-343	5	33
β-strand	346-351	6	33
β-strand	357-363	7	29
β-strand	371-375	5	29
β-strand	379-384	6	33
β-strand	390-394	5	29
α-helix	398-399	2
β-strand	400-402	3	29
β-strand	403-404	2	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chikv E1	F	protein	432	Chikungunya virus	Q1H8W5
C37 Heavy Chain	H	protein	265	Homo sapiens
C37 light chain	L	protein	237	Homo sapiens
Togavirin	P	protein	406	Chikungunya virus	Q1H8W5

Sequence of entity 1 (F), FASTA

>9IW2_1 CHIKV E1 (chains F)
GGGGSGGGGSGGGGSGGGGSYEHVTVIPNTVGVPYKTLVNRPGYSPMVLEMELLSVTLEP
TLSLDYITCEYKTVIPSPYVKCCGTAECKDKNLPDYSCKVFTGVYPFMWGGAYCFCDAEN
TQLSEAHVEKSESCKTEFASAYRAHTASASAKLRVLYQGNNITVTAYANGDHAVTVKDAK
FIVGPMSSAWTPFDNKIVVYKGDVYNMDYPPFGAGRPGQFGDIQSRTPESKDVYANTQLV
LQRPAAGTVHVPYSQAPSGFKYWLKERGASLQHTAPFGCQIATNPVRAVNCAVGNMPISI
DIPEAAFTRVVDAPSLTDMSCEVPACTHSSDFGGVAIIKYAASKKGKCAVHSMTNAVTIR
EAEIEVEGNSQLQISFSTALASAEFRVQVCSTQVHCAAECHPPKDHIVNYPASHTTLGVQ
DISATAMSWVQK

Sequence of entity 2 (H), FASTA

>9IW2_2 C37 Heavy Chain (chains H)
EFATMETDTLLLWVLLLWVPGSTGDQVQLQESGPGLVKPSETLSLTCTVSGGSIGSSSYY
WGWIRQPPGKGLQWIGSFHYSGTTYYNPSLKSRVTISVDTSKNHFSLKLSSVTAADTAVY
YCASRQNWNDGYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV
DKRVEPKSCDKTHTCPPCPHHHHHH

Sequence of entity 3 (L), FASTA

>9IW2_3 C37 light chain (chains L)
METDTLLLWVLLLWVPGSTGDDIQMTQSPATLSLSPGERATLFCRASQSVSSSLAWYQQK
PGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRGNWPPITF
GQGTRLDTKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGN
SQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECS

Sequence of entity 4 (P), FASTA

>9IW2_4 Togavirin (chains P)
MSLAIPVMCLLANTTFPCSQPPCTPCCYEKEPEETLRMLEDNVMRPGYYQLLQASLTCSP
HRQRRSTKDNFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIG
IKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGF
TDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDT
PDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKW
QYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLL
SYRNMGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQ

Primary citation

Neutralizing antibodies against Chikungunya virus and structural elucidation of their mechanism of action. Han, X., Ji, C., Tian, S. et al. Nat Commun (2025) 16:9682-9682. DOI 10.1038/s41467-025-64687-2 · PubMed

Other PDB entries of the same protein (UniProt Q1H8W5), best resolution first:

3N40 2.17 Å, Crystal structure of the immature envelope glycoprotein complex of Chikungunya virus.
3N44 2.35 Å, Crystal structure of the mature envelope glycoprotein complex (trypsin cleavage; Osmium…
3N43 2.58 Å, Crystal structures of the mature envelope glycoprotein complex (trypsin cleavage) of…
3N42 3.0 Å, Crystal structures of the mature envelope glycoprotein complex (furin cleavage) of…
3N41 3.01 Å, Crystal structure of the mature envelope glycoprotein complex (spontaneous cleavage) of…
3J2W 5.0 Å, Electron cryo-microscopy of Chikungunya virus
2XFB 9.0 Å, Chikungunya E1 E2 envelope glycoproteins fitted in sindbis virus cryo- EM map
2XFC 9.0 Å, Chikungunya E1 E2 envelope glycoproteins fitted in semliki forest virus cryo-EM map
5ANY 16.9 Å, Electron cryo-microscopy of chikungunya virus in complex with neutralizing antibody Fab…

Browse structure collections

About this viewer

MolViewer shows 9IW2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.