3NWH: BST2/Tetherin

Crystal structure of BST2/Tetherin. Determined by X-ray diffraction at 2.6 Å resolution. Released 21 Jul 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,266
Mol. weight: 50.43 kDa
Released: 21 Jul 2010

Explore 3NWH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NWH contains 5 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	51-149	99

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	49-111	63
α-helix	116-149	34

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	49-150	102

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bone marrow stromal antigen 2	A, B, C, D	protein	112	Homo sapiens	Q10589 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3NWH_1 Bone marrow stromal antigen 2 (chains A, B, C, D)
GIDPFTKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMA
SLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKK

Primary citation

Structural and functional studies on the extracellular domain of BST2/tetherin in reduced and oxidized conformations. Schubert, H.L., Zhai, Q., Sandrin, V. et al. Proc Natl Acad Sci U S A (2010) 107:17951-17956. DOI 10.1073/pnas.1008206107 · PubMed

Other PDB entries of the same protein (UniProt Q10589 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Q9A 2.1 Å, MHC Class I A02 Allele presenting LLLGIGILVL, in complex with Mel5 TCR
3MQ7 2.28 Å, Crystal Structure of Ectodomain Mutant of BST-2/Tetherin/CD317
2X7A 2.77 Å, Structural basis of HIV-1 tethering to membranes by the Bst2-tetherin ectodomain
3MQ9 2.8 Å, Crystal Structure of Ectodomain Mutant of BST-2/Tetherin/CD317 Fused to MBP
3MQC 2.8 Å, Crystal Structure of Ectodomain of BST-2/Tetherin/CD317 (P21)
4P6Z 3.0 Å, Crystal structure of the human BST2 cytoplasmic domain and the HIV-1 Vpu cytoplasmic…
3MQB 3.2 Å, Crystal Structure of Ectodomain of BST-2/Tetherin/CD317 (C2)
2XG7 3.45 Å, Crystal Structure of BST2-Tetherin Ectodomain expressed in HEK293T cells
6CM9 3.73 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef closed trimer monomeric subunit
6DFF 3.9 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef monomer
6D83 4.27 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant…
6D84 6.72 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant dimer

Browse structure collections

About this viewer

MolViewer shows 3NWH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.