PDE4B In complex with ligand an2898. Determined by X-ray diffraction at 1.95 Å resolution. Released 10 Aug 2011.
Explore 3O0J in 3D Show helices and sheets RCSB PDB PDBe
3O0J contains 23 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 163-170 | 8 | |
| α-helix | 180-186 | 7 | |
| α-helix | 191-202 | 12 | |
| α-helix | 205-208 | 4 | |
| α-helix | 213-225 | 13 | |
| α-helix | 236-250 | 15 | |
| α-helix | 253-255 | 3 | |
| α-helix | 261-273 | 13 | |
| α-helix | 283-288 | 6 | |
| α-helix | 292-296 | 5 | |
| α-helix | 302-313 | 12 | |
| α-helix | 314-316 | 3 | |
| α-helix | 328-343 | 16 | |
| α-helix | 347-349 | 3 | |
| α-helix | 350-362 | 13 | |
| β-strand | 366 | 1 | 1 |
| β-strand | 372 | 1 | 1 |
| α-helix | 377-392 | 16 | |
| α-helix | 395-397 | 3 | |
| α-helix | 400-423 | 24 | |
| α-helix | 426-429 | 4 | |
| α-helix | 439-446 | 8 | |
| α-helix | 447-451 | 5 | |
| α-helix | 452-462 | 11 | |
| α-helix | 467-482 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cAMP-specific 3',5'-cyclic phosphodiesterase 4B | A | protein | 323 | Homo sapiens | Q07343 (AlphaFold model) |
>3O0J_1 cAMP-specific 3',5'-cyclic phosphodiesterase 4B (chains A) NEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMM TLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGV SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDM VLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLE LYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADL VQPDAQDILDTLEDNRNWYQSMI
| ID | Name | Formula | Copies |
|---|---|---|---|
| 3OJ | 4-[(1-hydroxy-1,3-dihydro-2,1-benzoxaborol-5-yl)oxy]benzene-1,2-dicarbonitrile | C15 H9 B N2 O3 | 1 |
| MG | Magnesium ion | Mg | 1 |
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (EDO) are not listed.
Boron-based phosphodiesterase inhibitors show novel binding of boron to PDE4 bimetal center. Freund, Y.R., Akama, T., Alley, M.R. et al. FEBS Lett (2012) 586:3410-3414. DOI 10.1016/j.febslet.2012.07.058 · PubMed
Other PDB entries of the same protein (UniProt Q07343 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3O0J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.