3O8Z: Spn1 (Iws1) core domain

Crystal structure of Spn1 (Iws1) core domain. Determined by X-ray diffraction at 2.15 Å resolution. Released 24 Nov 2010.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,360
Mol. weight: 17.35 kDa
Released: 24 Nov 2010

Explore 3O8Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3O8Z contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	145-182	38
α-helix	191-204	14
α-helix	206-208	3
α-helix	209-214	6
α-helix	218-225	8
α-helix	227-228	2
α-helix	232-235	4
α-helix	236-248	13
α-helix	253-259	7
α-helix	261-270	10
α-helix	276-294	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor IWS1	A	protein	152	Saccharomyces cerevisiae	Q06505 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3O8Z_1 Transcription factor IWS1 (chains A)
DPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVL
SKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGR
VVIFYTKSKRVEAQLARLAEKLIAEWTRPIIG

Primary citation

Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding. McDonald, S.M., Close, D., Xin, H. et al. Mol Cell (2010) 40:725-735. DOI 10.1016/j.molcel.2010.11.014 · PubMed

Other PDB entries of the same protein (UniProt Q06505 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NFQ 1.85 Å, Crystal structure of the conserved central domain of yeast Spn1/Iws1
3OAK 2.15 Å, Crystal structure of a Spn1 (Iws1)-Spt6 complex

Browse structure collections

About this viewer

MolViewer shows 3O8Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.