Structure and Function of a Ubiquitin Binding Site within the Catalytic Domain of a HECT Ubiquitin Ligase. Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Mar 2011.
Explore 3OLM in 3D Show helices and sheets RCSB PDB PDBe
3OLM contains 29 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 388-390 | 3 | |
| β-strand | 405-407 | 3 | 1 |
| β-strand | 412-414 | 3 | 1 |
| α-helix | 423-425 | 3 | |
| α-helix | 430-443 | 14 | |
| α-helix | 446-448 | 3 | |
| β-strand | 455-460 | 6 | 2 |
| α-helix | 464-474 | 11 | |
| α-helix | 477-480 | 4 | |
| β-strand | 484-489 | 6 | 2 |
| α-helix | 502-511 | 10 | |
| α-helix | 514-516 | 3 | |
| β-strand | 519-521 | 3 | 3 |
| β-strand | 529-531 | 3 | 3 |
| α-helix | 533-537 | 5 | |
| α-helix | 541-557 | 17 | |
| α-helix | 560-562 | 3 | |
| β-strand | 566 | 1 | 3 |
| α-helix | 568-574 | 7 | |
| α-helix | 581-587 | 7 | |
| α-helix | 589-598 | 10 | |
| β-strand | 610 | 1 | 4 |
| β-strand | 612-617 | 6 | 5 |
| β-strand | 620-625 | 6 | 5 |
| α-helix | 630-632 | 3 | |
| β-strand | 634 | 1 | 4 |
| α-helix | 640-649 | 10 | |
| α-helix | 650-654 | 5 | |
| α-helix | 657-668 | 12 | |
| α-helix | 673-676 | 4 | |
| α-helix | 681-688 | 8 | |
| β-strand | 691 | 1 | 6 |
| α-helix | 696-701 | 6 | |
| β-strand | 703-706 | 4 | 7 |
| α-helix | 713-724 | 12 | |
| α-helix | 727-738 | 12 | |
| β-strand | 743 | 1 | 6 |
| α-helix | 748-750 | 3 | |
| β-strand | 752-753 | 2 | 8 |
| β-strand | 756-757 | 2 | 8 |
| β-strand | 760-763 | 4 | 7 |
| α-helix | 771-772 | 2 | |
| β-strand | 773-775 | 3 | 7 |
| α-helix | 776-778 | 3 | |
| β-strand | 780-782 | 3 | 7 |
| α-helix | 789-802 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 9 |
| β-strand | 12-16 | 5 | 9 |
| β-strand | 22 | 1 | 10 |
| α-helix | 23-34 | 12 | |
| β-strand | 41-44 | 4 | 9 |
| β-strand | 49 | 1 | 9 |
| β-strand | 55 | 1 | 10 |
| α-helix | 65 | 1 | |
| β-strand | 66-71 | 6 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase RSP5 | A | protein | 429 | Saccharomyces cerevisiae | P39940 (AlphaFold model) |
| Ubiquitin | D | protein | 79 | Saccharomyces cerevisiae | P0CG63 (AlphaFold model) |
>3OLM_1 E3 ubiquitin-protein ligase RSP5 (chains A) SNASQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVI YFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLDYGGVS REFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRR FLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGE VVTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFD ERELELLIGGIAEIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGT SRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAV EETIGFGQE
>3OLM_2 Ubiquitin (chains D) SNAMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS DYNIQKESTLHLVLRLRGG
Structure and function of a HECT domain ubiquitin-binding site. Kim, H.C., Steffen, A.M., Oldham, M.L. et al. EMBO Rep (2011) 12:334-341. DOI 10.1038/embor.2011.23 · PubMed
Other PDB entries of the same protein (UniProt P39940 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3OLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.