3OP0: Cbl-c (Cbl-3) TKB domain

Crystal structure of Cbl-c (Cbl-3) TKB domain in complex with EGFR pY1069 peptide. Determined by X-ray diffraction at 2.52 Å resolution. Released 20 Oct 2010.

Method: X-ray diffraction
Resolution: 2.52 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,481
Mol. weight: 75.08 kDa
Ligands: NI
Released: 20 Oct 2010

Explore 3OP0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OP0 contains 36 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 17 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	13-31	19
α-helix	44-63	20
α-helix	76-97	22
α-helix	108-111	4
β-strand	115	1	1
α-helix	116-138	23
α-helix	140-142	3
α-helix	154-164	11
β-strand	169-171	3	2
α-helix	172-180	9
α-helix	189-198	10
β-strand	205-207	3	2
α-helix	208-217	10
α-helix	221-223	3
α-helix	224-228	5
α-helix	229-233	5
β-strand	238	1	3
α-helix	244-250	7
α-helix	253-256	4
β-strand	260-265	6	3
β-strand	273-278	6	3
β-strand	284-287	4	3
α-helix	294-303	10
β-strand	309-310	2	3
α-helix	320-329	10

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1070	1	3
α-helix	1071-1072	2

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1070-1072	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal transduction protein CBL-C	A, B	protein	323	Homo sapiens	Q9ULV8 (AlphaFold model)
Epidermal growth factor receptor	C, D	protein	11	Homo sapiens	P00533 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3OP0_1 Signal transduction protein CBL-C (chains A, B)
MGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRREAGG
GGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQLAKLAII
FSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEP
GCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEV
QERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFY
LYPDGKTHNPDLTELGAENLYFQ

Sequence of entity 2 (C, D), FASTA

>3OP0_2 Epidermal growth factor receptor (chains C, D)
LQRYSSDPTGA

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	2

Water and common crystallization additives (NA) are not listed.

Primary citation

Crystal structure of Cbl-c (Cbl-3) TKB domain in complex with EGFR pY1069 peptide. Chaikuad, A., Guo, K., Cooper, C.D.O. et al. To be published.

Other PDB entries of the same protein (UniProt Q9ULV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VRP 1.52 Å, Crystal structure of the tyrosine kinase binding domain of Cbl-c in complex with…
3VRN 1.64 Å, Crystal structure of the tyrosine kinase binding domain of Cbl-c
3VRO 1.8 Å, Crystal structure of the tyrosine kinase binding domain of Cbl-c in complex with…
9OGW 1.8 Å, Identification of ligands for E3 ligases using fragment-based methods
3VRR 2.0 Å, Crystal structure of the tyrosine kinase binding domain of Cbl-c (PL mutant) in complex…
3VRQ 2.39 Å, Crystal structure of the tyrosine kinase binding domain of Cbl-c (PL mutant)

Browse structure collections

About this viewer

MolViewer shows 3OP0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.