3P9Y: Drosophila melanogaster Ssu72-pCTD complex

Crystal structure of the Drosophila melanogaster Ssu72-pCTD complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 15 Dec 2010.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Drosophila melanogaster, synthetic construct
Chains: 8
Atoms: 7,285
Mol. weight: 96.13 kDa
Released: 15 Dec 2010

Explore 3P9Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3P9Y contains 31 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	1
α-helix	19-29	11
β-strand	33-38	6	1
β-strand	43-45	3	2
β-strand	54-56	3	2
α-helix	62-79	18
α-helix	82-92	11
β-strand	98	1	1
α-helix	99-101	3
β-strand	108-111	4	1
α-helix	114-125	12
α-helix	128-129	2
β-strand	134-139	6	1
α-helix	146-164	19
α-helix	169-184	16
β-strand	189-194	6	1

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	3
α-helix	19-29	11
β-strand	33-38	6	3
β-strand	43-49	7	4
β-strand	52-56	5	4
α-helix	62-73	12
α-helix	76-79	4
α-helix	82-92	11
β-strand	98	1	3
α-helix	99-101	3
β-strand	108-111	4	3
α-helix	114-126	13
β-strand	134-139	6	3
α-helix	146-164	19
α-helix	169-184	16
β-strand	189-194	6	3

Chain C: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	5
α-helix	19-29	11
β-strand	33-38	6	5
β-strand	43-45	3	6
β-strand	54-56	3	6
α-helix	62-79	18
α-helix	82-92	11
β-strand	98	1	5
α-helix	99-101	3
β-strand	108-111	4	5
α-helix	114-126	13
β-strand	134-139	6	5
α-helix	146-164	19
α-helix	169-184	16
β-strand	189-194	6	5

Chain D: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	7
α-helix	19-30	12
β-strand	33-38	6	7
β-strand	43-49	7	8
β-strand	52-56	5	8
α-helix	62-79	18
α-helix	82-90	9
β-strand	98	1	7
α-helix	99-101	3
β-strand	108-111	4	7
α-helix	114-126	13
α-helix	128-129	2
β-strand	134-140	7	7
α-helix	146-164	19
α-helix	169-184	16
β-strand	188-194	7	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CG14216	A, B, C, D	protein	198	Drosophila melanogaster	Q9VWE4 (AlphaFold model)
pSer5 CTD peptide	E, F, G, H	protein	7	synthetic construct

Sequence of entity 1 (A, B, C, D), FASTA

>3P9Y_1 CG14216 (chains A, B, C, D)
GSHMTDPSKLAVAVVDSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYE
FGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVY
DLVVMHMESMESVDNRPVHVLNVDVVNNAEDALMGAFVITDMINMMAKSTDLDNDIDELI
QEFEERRKRVILHSVLFY

Sequence of entity 2 (E, F, G, H), FASTA

>3P9Y_2 pSer5 CTD peptide (chains E, F, G, H)
PTSPSYS

Primary citation

cis-Proline-mediated Ser(P)5 Dephosphorylation by the RNA Polymerase II C-terminal Domain Phosphatase Ssu72. Werner-Allen, J.W., Lee, C.J., Liu, P. et al. J Biol Chem (2011) 286:5717-5726. DOI 10.1074/jbc.M110.197129 · PubMed

Other PDB entries of the same protein (UniProt Q9VWE4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3OMX 2.34 Å, Crystal structure of Ssu72 with vanadate complex
4IMI 2.35 Å, Novel Modifications on C-terminal Domain of RNA Polymerase II can Fine- tune the…
6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
4IMJ 2.58 Å, Novel Modifications on C-terminal Domain of RNA Polymerase II can Fine-tune the…
3OMW 2.87 Å, Crystal structure of Ssu72, an essential eukaryotic phosphatase specific for the…
4YGX 2.95 Å, Crystal Structure of D. melanogaster Ssu72+Symplekin bound to cis peptidomimetic CTD…
3FDF 3.2 Å, Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily)…
3FMV 3.31 Å, Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily)…

Browse structure collections

About this viewer

MolViewer shows 3P9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.