Phosphofructokinase. Structure and control. Determined by X-ray diffraction at 2.4 Å resolution. Released 9 Jan 1989.
Explore 3PFK in 3D Show helices and sheets RCSB PDB PDBe
3PFK contains 15 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 1 |
| α-helix | 16-29 | 14 | |
| β-strand | 33-37 | 5 | 1 |
| α-helix | 40-45 | 6 | |
| β-strand | 49-52 | 4 | 1 |
| α-helix | 54-57 | 4 | |
| α-helix | 74-76 | 3 | |
| α-helix | 79-92 | 14 | |
| β-strand | 96-101 | 6 | 1 |
| α-helix | 103-114 | 12 | |
| β-strand | 119-123 | 5 | 1 |
| β-strand | 124 | 1 | 2 |
| β-strand | 137 | 1 | 2 |
| α-helix | 139-159 | 21 | |
| β-strand | 163-168 | 6 | 3 |
| α-helix | 175-184 | 10 | |
| β-strand | 188-190 | 3 | 3 |
| α-helix | 198-210 | 13 | |
| β-strand | 216-221 | 6 | 3 |
| α-helix | 227-238 | 12 | |
| β-strand | 242-246 | 5 | 3 |
| α-helix | 248-252 | 5 | |
| α-helix | 255-257 | 3 | |
| α-helix | 258-276 | 19 | |
| β-strand | 282-287 | 6 | 1 |
| β-strand | 290-295 | 6 | 1 |
| α-helix | 296-300 | 5 | |
| α-helix | 309-317 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphofructokinase | A | protein | 319 | Geobacillus stearothermophilus | P00512 (AlphaFold model) |
>3PFK_1 PHOSPHOFRUCTOKINASE (chains A) MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDI IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIQGLVVIGGDGSYQGAKKLTEHGFPCV GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS GLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL ANKHTIDQRMYALSKELSI
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 2 |
Phosphofructokinase: structure and control. Evans, P.R., Farrants, G.W., Hudson, P.J. Philos Trans R Soc London,ser B (1981) 293:53-62. PubMed
Other PDB entries of the same protein (UniProt P00512 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3PFK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.