3PQR: Metarhodopsin II

Crystal structure of Metarhodopsin II in complex with a C-terminal peptide derived from the Galpha subunit of transducin. Determined by X-ray diffraction at 2.85 Å resolution. Released 9 Mar 2011.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Bos taurus
Chains: 2
Atoms: 2,904
Mol. weight: 42.94 kDa
Ligands: NAG, PLM, BOG, RET
Released: 9 Mar 2011

Explore 3PQR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PQR contains 19 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	9-11	3	1
α-helix	15-17	3
α-helix	34-64	31
α-helix	66-68	3
α-helix	71-85	15
α-helix	86-91	6
α-helix	92-100	9
α-helix	106-140	35
α-helix	150-168	19
α-helix	170-172	3
β-strand	178-181	4	2
β-strand	186-189	4	2
α-helix	196-198	3
α-helix	200-208	9
α-helix	209-213	5
α-helix	214-235	22
α-helix	241-277	37
α-helix	287-289	3
α-helix	290-303	14
α-helix	304-308	5
α-helix	311-321	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	341-346	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rhodopsin	A	protein	348	Bos taurus	P02699 (AlphaFold model)
Guanine nucleotide-binding protein G(t) subunit alpha-1	B	protein	11	Bos taurus	P04695 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3PQR_1 Rhodopsin (chains A)
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLY
VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG
GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP
EGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES
ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Sequence of entity 2 (B), FASTA

>3PQR_2 Guanine nucleotide-binding protein G(t) subunit alpha-1 (chains B)
ILENLKDVGLF

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
PLM	Palmitic acid	C16 H32 O2	1
BOG	octyl beta-D-glucopyranoside	C14 H28 O6	2
RET	Retinal	C20 H28 O	1

Water and common crystallization additives (SO4, ACT) are not listed.

Primary citation

Crystal structure of metarhodopsin II. Choe, H.W., Kim, Y.J., Park, J.H. et al. Nature (2011) 471:651-655. DOI 10.1038/nature09789 · PubMed

Other PDB entries of the same protein (UniProt P02699 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZBC 1.8 Å, Dark state crystal structure of bovine rhodopsin in Lipidic Cubic Phase (SACLA)
7ZBE 1.8 Å, Dark state crystal structure of bovine rhodopsin in Lipidic Cubic Phase (SwissFEL)
8A6C 1.8 Å, 1 picosecond light activated crystal structure of bovine rhodopsin in Lipidic Cubic Phase
8A6D 1.8 Å, 10 picosecond light activated crystal structure of bovine rhodopsin in Lipidic Cubic Phase
8A6E 1.8 Å, 100 picosecond light activated crystal structure of bovine rhodopsin in Lipidic Cubic…
1U19 2.2 Å, Crystal Structure of Bovine Rhodopsin at 2.2 Angstroms Resolution
4X1H 2.29 Å, Opsin/G(alpha) peptide complex stabilized by nonyl-glucoside
5DYS 2.3 Å, Crystal Structure of T94I rhodopsin mutant
6FK6 2.36 Å, Crystal structure of N2C/D282C stabilized opsin bound to RS01
6FKC 2.46 Å, Crystal structure of N2C/D282C stabilized opsin bound to RS15
6FKD 2.49 Å, Crystal structure of N2C/D282C stabilized opsin bound to RS16
1L9H 2.6 Å, Crystal structure of bovine rhodopsin at 2.6 angstroms RESOLUTION

Browse structure collections

About this viewer

MolViewer shows 3PQR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.