Structure of a viral OTU domain protease bound to interferon-stimulated gene 15 (ISG15). Determined by X-ray diffraction at 2.3 Å resolution. Released 19 Jan 2011.
Explore 3PSE in 3D Show helices and sheets RCSB PDB PDBe
3PSE contains 20 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-5 | 5 | |
| β-strand | 10-13 | 4 | 1 |
| β-strand | 16-19 | 4 | 1 |
| β-strand | 24 | 1 | 2 |
| α-helix | 25-27 | 3 | |
| β-strand | 29-32 | 4 | 1 |
| α-helix | 40-49 | 10 | |
| α-helix | 58-72 | 15 | |
| α-helix | 73-75 | 3 | |
| α-helix | 79-82 | 4 | |
| α-helix | 86-93 | 8 | |
| β-strand | 101 | 1 | 3 |
| α-helix | 102-111 | 10 | |
| β-strand | 116-121 | 6 | 1 |
| β-strand | 126 | 1 | 2 |
| β-strand | 127-133 | 7 | 1 |
| β-strand | 142-147 | 6 | 1 |
| β-strand | 151-157 | 7 | 1 |
| α-helix | 159-161 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-9 | 5 | 4 |
| β-strand | 15-17 | 3 | 4 |
| α-helix | 25-36 | 12 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-48 | 6 | 4 |
| α-helix | 52 | 1 | |
| β-strand | 53 | 1 | 4 |
| α-helix | 54-55 | 2 | |
| α-helix | 60-62 | 3 | |
| β-strand | 70-75 | 6 | 4 |
| β-strand | 82-87 | 6 | 5 |
| β-strand | 93-98 | 6 | 5 |
| β-strand | 103 | 1 | 6 |
| α-helix | 104-115 | 12 | |
| α-helix | 119-121 | 3 | |
| β-strand | 122-126 | 5 | 5 |
| β-strand | 129-130 | 2 | 5 |
| α-helix | 131-132 | 2 | |
| β-strand | 136 | 1 | 6 |
| α-helix | 137-140 | 4 | |
| α-helix | 146 | 1 | |
| β-strand | 147-152 | 6 | 5 |
| α-helix | 153 | 1 | |
| β-strand | 155 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNA polymerase | A | protein | 171 | Crimean-Congo hemorrhagic fever virus | Q6TQR6 (AlphaFold model) |
| Ubiquitin-like protein ISG15 | B | protein | 156 | Homo sapiens | P05161 (AlphaFold model) |
>3PSE_1 RNA polymerase (chains A) GPMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSY HYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIII WTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFETDTREAL
>3PSE_2 Ubiquitin-like protein ISG15 (chains B) MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL ASQGLGPGSTVLLVVDKSDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRG
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4LJ | 1.7.6 3-bromanylpropan-1-amine | C3 H8 Br N | 1 |
Water and common crystallization additives (GOL) are not listed.
Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease. James, T.W., Frias-Staheli, N., Bacik, J.P. et al. Proc Natl Acad Sci U S A (2011) 108:2222-2227. DOI 10.1073/pnas.1013388108 · PubMed
Other PDB entries of the same protein (UniProt Q6TQR6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3PSE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.