3PSF: Transcription elongation factor SPT6

Name: PDB 3PSF: Crystal Structure of the Spt6 core domain from Saccharomyces cerevisiae, Form Spt6(236-1259)
Published: 2011-03-30
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal Structure of the Spt6 core domain from Saccharomyces cerevisiae, Form Spt6(236-1259). Determined by X-ray diffraction at 2.59 Å resolution. Released 30 Mar 2011.

Method: X-ray diffraction
Resolution: 2.59 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 6,789
Mol. weight: 119.2 kDa
Released: 30 Mar 2011

Explore 3PSF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PSF contains 55 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 55 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	301-308	8
α-helix	312-319	8
α-helix	324-329	6
α-helix	330-332	3
α-helix	341-359	19
α-helix	368-382	15
α-helix	388-394	7
α-helix	396-398	3
β-strand	400	1	1
β-strand	408	1	1
α-helix	411-441	31
α-helix	446-454	9
α-helix	465-476	12
α-helix	478-483	6
α-helix	502-505	4
α-helix	511-515	5
α-helix	521-530	10
α-helix	545-554	10
α-helix	568-583	16
α-helix	586-598	13
β-strand	600-606	7	2
α-helix	608-613	6
β-strand	626	1	3
β-strand	629	1	2
α-helix	633-636	4
α-helix	639-649	11
β-strand	653-659	7	2
α-helix	662-673	12
α-helix	681-733	53
α-helix	736-738	3
α-helix	747-749	3
β-strand	750-754	5	4
α-helix	764	1
β-strand	765-770	6	4
β-strand	776-782	7	4
α-helix	793-806	14
β-strand	810-813	4	4
α-helix	819-833	15
β-strand	837	1	5
α-helix	842	1
β-strand	843	1	5
α-helix	844-845	2
β-strand	846-848	3	4
α-helix	854-858	5
α-helix	861-866	6
α-helix	872-885	14
α-helix	887-892	6
α-helix	896-900	5
α-helix	908-910	3
α-helix	913-931	19
β-strand	933-934	2	6
α-helix	935-939	5
α-helix	942-945	4
α-helix	948-950	3
α-helix	956-968	13
α-helix	978-981	4
α-helix	987-993	7
β-strand	997-998	2	6
α-helix	1015-1018	4
α-helix	1023-1025	3
α-helix	1026-1036	11
α-helix	1041-1050	10
α-helix	1055-1062	8
α-helix	1066-1070	5
α-helix	1075-1086	12
α-helix	1091-1102	12
α-helix	1110-1112	3
α-helix	1114-1116	3
α-helix	1117-1125	9
β-strand	1225	1	3
α-helix	1227-1246	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation factor SPT6	A	protein	1030	Saccharomyces cerevisiae	P23615 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3PSF_1 Transcription elongation factor SPT6 (chains A)
GIDPFTGLSSDKIDEMYDIFGDGHDYDWALEIENEELENGNDNNEAEEEEIDEETGAIKS
TKKKISLQDIYDLEDLKKNLMTEGDMKIRKTDIPERYQELRAGITDYGNMSSEDQELERN
WIAEKISVDKNFDANYDLTEFKEAIGNAIKFITKENLEVPFIYAYRRNYISSREKDGFLL
TEDDLWDIVSLDIEFHSLVNKKDYVQRFYAELHIDDPIVTEYFKNQNTASIAELNSLQDI
YDYLEFKYANEINEMFINHTGKTGKKHLKNSSYEKFKASPLYQAVSDIGISAEDVGENIS
SQHQIHPPVDHPSSKPVEVIESILNANSGDLQVFTSNTKLAIDTVQKYYSLELSKNTKIR
EKVRSDFSKYYLADVVLTAKGKKEIQKGSLYEDIKYAINRTPMHFRRDPDVFLKMVEAES
LNLLSVKLHMSSQAQYIEHLFQIALETTNTSDIAIEWNNFRKLAFNQAMDKIFQDISQEV
KDNLTKNCQKLVAKTVRHKFMTKLDQAPFIPNVRDPKIPKILSLTCGQGRFGADAIIAVY
VNRKGDFIRDYKIVDNPFDKTNPEKFEDTLDNIIQSCQPNAIGINGPNPKTQKFYKRLQE
VLHKKQIVDSRGHTIPIIYVEDEVAIRYQNSERAAQEFPNKPPLVKYCIALARYMHSPLL
EYANLTSEEVRSLSIHPHQNLLSSEQLSWALETAFVDIVNLVSVEVNKATDNNYYASALK
YISGFGKRKAIDFLQSLQRLNEPLLARQQLITHNILHKTIFMNSAGFLYISWNEKRQKYE
DLEHDQLDSTRIHPEDYHLATKVAADALEYDPDTIAEKEEQGTMSEFIELLREDPDRRAK
LESLNLESYAEELEKNTGLRKLNNLNTIVLELLDGFEELRNDFHPLQGDEIFQSLTGESE
KTFFKGSIIPVRVERFWHNDIICTTNSEVECVVNAQRHAGAQLRRPANEIYEIGKTYPAK
VIYIDYANITAEVSLLDHDVKQQYVPISYSKDPSIWDLKQELEDAEEERKLMMAEARAKR
THRVINHPYY

Primary citation

Crystal structures of the S. cerevisiae Spt6 core and C-terminal tandem SH2 domain. Close, D., Johnson, S.J., Sdano, M.A. et al. J Mol Biol (2011) 408:697-713. DOI 10.1016/j.jmb.2011.03.002 · PubMed

Other PDB entries of the same protein (UniProt P23615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VKO 1.8 Å, SPT6 tSH2-RPB1 1468-1500 pT1471, pS1493
3PSK 2.1 Å, Crystal Structure of the Spt6 Tandem SH2 Domain from Saccharomyces cerevisiae, Form…
3OAK 2.15 Å, Crystal structure of a Spn1 (Iws1)-Spt6 complex
5VKL 2.2 Å, SPT6 tSH2-RPB1 1476-1500 pS1493
3PSJ 2.7 Å, Crystal Structure of the Spt6 Tandem SH2 Domain from Saccharomyces cerevisiae, Form…
3PSI 3.3 Å, Crystal Structure of the Spt6 core domain from Saccharomyces cerevisiae, Form…
7O3D 3.71 Å, Cooperation between the intrinsically disordered and ordered regions of Spt6 regulates…
7O6B 3.88 Å, Cooperation between the intrinsically disordered and ordered regions of Spt6 regulates…
2L3T Solution structure of tandem SH2 domain from Spt6

Browse structure collections

About this viewer

MolViewer shows 3PSF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.