3PWV: MHC class I antigen

An immmunodominant CTL epitope from rinderpest virus presented by cattle MHC class I molecule N*01801 (BoLA-A11). Determined by X-ray diffraction at 2.7 Å resolution. Released 24 Aug 2011.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Bos taurus, Rinderpest virus
Chains: 6
Atoms: 6,381
Mol. weight: 88.79 kDa
Released: 24 Aug 2011

Explore 3PWV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PWV contains 27 α-helices and 60 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-11	10	1
α-helix	19	1
β-strand	20-27	8	1
β-strand	30-36	7	1
β-strand	45-46	2	1
α-helix	49-51	3
α-helix	56-84	29
β-strand	93-102	10	1
β-strand	108-117	10	1
β-strand	120-125	6	1
β-strand	132-134	3	1
α-helix	137-148	12
α-helix	151-160	10
α-helix	162-173	12
α-helix	175-178	4
α-helix	181	1
β-strand	182	1	2
α-helix	183-184	2
β-strand	185-192	8	3
β-strand	197-207	11	3
β-strand	208	1	2
β-strand	213-218	6	4
β-strand	221-222	2	4
β-strand	227-229	3	3
α-helix	230-232	3
β-strand	233-234	2	3
β-strand	240-249	10	3
α-helix	253-255	3
β-strand	257-261	5	4
β-strand	269-271	3	4

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
α-helix	4-5	2
β-strand	6-11	6	6
α-helix	14-15	2
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	36-41	6	7
β-strand	44-45	2	7
β-strand	49-50	2	6
α-helix	51-53	3
β-strand	54-55	2	6
β-strand	61-69	9	6
β-strand	77-82	6	7
β-strand	90-93	4	7

Chain D: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-11	10	8
α-helix	19	1
β-strand	20-27	8	8
β-strand	30-36	7	8
β-strand	45-46	2	8
α-helix	49-51	3
α-helix	56-83	28
β-strand	93-102	10	8
β-strand	108-117	10	8
β-strand	120-125	6	8
β-strand	132-134	3	8
α-helix	138-148	11
α-helix	151-157	7
α-helix	158-162	5
α-helix	163-173	11
α-helix	181	1
β-strand	182	1	9
α-helix	183-184	2
β-strand	185-192	8	10
β-strand	197-207	11	10
β-strand	208	1	9
β-strand	213-218	6	11
β-strand	221-222	2	11
β-strand	227-229	3	10
α-helix	230-232	3
β-strand	233-234	2	10
β-strand	240-249	10	10
α-helix	253-255	3
β-strand	257-261	5	11
β-strand	269-271	3	11

Chain E: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	12
β-strand	6-11	6	13
α-helix	14-15	2
β-strand	21-30	10	13
β-strand	31	1	12
β-strand	36-41	6	14
β-strand	44-46	3	14
β-strand	49-50	2	13
α-helix	51-53	3
β-strand	54-55	2	13
β-strand	61-69	9	13
β-strand	77-82	6	14
β-strand	90-93	4	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class I antigen	A, D	protein	274	Bos taurus	Q95477 (AlphaFold model)
Beta-2-microglobulin	B, E	protein	98	Bos taurus	P01888 (AlphaFold model)
9-mer peptide from Hemagglutinin	C, F	protein	9	Rinderpest virus	Q9YKD7

Sequence of entity 1 (A, D), FASTA

>3PWV_1 MHC class I antigen (chains A, D)
SHSLRYFYTAVSRPGLGEPRFIAVGYVDDTQFTRFDSDAPNPRDEPRVPWMEQEGPEYWD
RNTRIYKDTAQIFRANLNTALGYYNQSEAGSHTFQEMYGCYVGPDGRLLLGFMQFAYDGR
DYIALNEDLRSWTAADTAAQITKRKWEAAGEAERQRNYLEGRCVEGLRRYLENGKDTLLR
ADPPKAHVTHHPISDREVTLRCWALGFYPEEISLTWQHEGEDQTQDMELVETRPSGDGTF
QKWAALVVPSGEEQRYTCRVQHEGLQEPLTLRWE

Sequence of entity 2 (B, E), FASTA

>3PWV_2 Beta-2-microglobulin (chains B, E)
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWS
FYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Sequence of entity 3 (C, F), FASTA

>3PWV_3 9-mer peptide from Hemagglutinin (chains C, F)
IPAYGVLTI

Primary citation

Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides. Li, X., Liu, J., Qi, J. et al. J Virol (2011) 85:6038-6048. DOI 10.1128/JVI.00030-11 · PubMed

Other PDB entries of the same protein (UniProt Q95477 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PWU 1.9 Å, An immmunodominant CTL epitope from rinderpest virus presented by cattle MHC class I…

Browse structure collections

About this viewer

MolViewer shows 3PWV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.