Crystal structure of the Drosophila kinesin family member Kin10/NOD in complex with divalent manganese and ADP. Determined by X-ray diffraction at 2.6 Å resolution. Released 21 Dec 2011.
Explore 3PXN in 3D Show helices and sheets RCSB PDB PDBe
3PXN contains 13 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-15 | 8 | 1 |
| α-helix | 16-18 | 3 | |
| β-strand | 31 | 1 | 2 |
| β-strand | 40-43 | 4 | 2 |
| β-strand | 46-49 | 4 | 2 |
| β-strand | 52-54 | 3 | 1 |
| α-helix | 60-67 | 8 | |
| α-helix | 69-76 | 8 | |
| β-strand | 81-87 | 7 | 1 |
| α-helix | 93-97 | 5 | |
| α-helix | 102-104 | 3 | |
| α-helix | 107-109 | 3 | |
| α-helix | 112-125 | 14 | |
| β-strand | 135-145 | 11 | 1 |
| β-strand | 149-151 | 3 | 1 |
| β-strand | 160 | 1 | 1 |
| β-strand | 172-173 | 2 | 1 |
| α-helix | 177-189 | 13 | |
| β-strand | 205-215 | 11 | 1 |
| β-strand | 219-226 | 8 | 1 |
| α-helix | 251-263 | 13 | |
| α-helix | 272-274 | 3 | |
| α-helix | 276-280 | 5 | |
| β-strand | 290-297 | 8 | 1 |
| α-helix | 301-303 | 3 | |
| α-helix | 304-320 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kinesin-like protein Nod | A | protein | 344 | Drosophila melanogaster | P18105 (AlphaFold model) |
>3PXN_1 Kinesin-like protein Nod (chains A) MASDYKDDDDKRRRGMEGAKLSAVRIAVREAPYRQFLGRREPSVVQFPPWSDGKSLIVDQ NEFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEI LPEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAAR CQRCTCLPLHSQADLHHILELGTRNRRVRPTNMNSNSSRSHAIVTIHVKSKTHHSRMNIV DLAGSEGVRRTGHEGVARQEGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASL TAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLEHHHHHH
A metal switch for controlling the activity of molecular motor proteins. Cochran, J.C., Zhao, Y.C., Wilcox, D.E. et al. Nat Struct Mol Biol (2012) 19:122-127. DOI 10.1038/nsmb.2190 · PubMed
Other PDB entries of the same protein (UniProt P18105 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3PXN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.