3Q49: TPR domain of CHIP

Crystal structure of the TPR domain of CHIP complexed with Hsp70-C peptide. Determined by X-ray diffraction at 1.54 Å resolution. Released 16 Mar 2011.

Method: X-ray diffraction
Resolution: 1.54 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,318
Mol. weight: 16.59 kDa
Released: 16 Mar 2011

Explore 3Q49 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q49 contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	27-39	13
α-helix	43-56	14
α-helix	61-73	13
α-helix	77-90	14
α-helix	95-107	13
α-helix	111-127	17
β-strand	132	1	1
β-strand	134	1	1
α-helix	135-152	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
STIP1 homology and U box-containing protein 1	B	protein	137	Mus musculus	Q9WUD1 (AlphaFold model)
Hsp70-C peptide	C	protein	8	Homo sapiens	P0DMV8 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>3Q49_1 STIP1 homology and U box-containing protein 1 (chains B)
GPHMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPE
QALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPS
ALRIAKKKRWNSIEERR

Sequence of entity 2 (C), FASTA

>3Q49_2 Hsp70-C peptide (chains C)
GPTIEEVD

Primary citation

Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP). Wang, L., Liu, Y.T., Hao, R. et al. J Biol Chem (2011) 286:15883-15894. DOI 10.1074/jbc.M110.201814 · PubMed

Other PDB entries of the same protein (UniProt Q9WUD1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q4A 1.54 Å, Crystal structure of the TPR domain of CHIP complexed with phosphorylated Smad1 peptide
3Q47 1.71 Å, Crystal structure of TPR domain of CHIP complexed with pseudophosphorylated Smad1 peptide
2C2V 2.9 Å, Crystal structure of the CHIP-UBC13-UEV1a complex
2C2L 3.3 Å, Crystal structure of the CHIP U-box E3 ubiquitin ligase

Browse structure collections

About this viewer

MolViewer shows 3Q49 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.