Structure of dually-phosphorylated MET receptor kinase in complex with an MK-2461 analog with specificity for the activated receptor. Determined by X-ray diffraction at 1.75 Å resolution. Released 19 Jan 2011.
Explore 3Q6W in 3D Show helices and sheets RCSB PDB PDBe
3Q6W contains 19 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1055-1057 | 3 | |
| α-helix | 1060-1068 | 9 | |
| β-strand | 1070-1071 | 2 | 1 |
| α-helix | 1073-1075 | 3 | |
| β-strand | 1076-1086 | 11 | 1 |
| β-strand | 1091-1098 | 8 | 1 |
| β-strand | 1104-1111 | 8 | 1 |
| α-helix | 1118-1129 | 12 | |
| β-strand | 1139 | 1 | 2 |
| α-helix | 1140-1142 | 3 | |
| β-strand | 1144-1146 | 3 | 1 |
| β-strand | 1154-1158 | 5 | 1 |
| β-strand | 1163-1164 | 2 | 2 |
| α-helix | 1165-1170 | 6 | |
| α-helix | 1178-1197 | 20 | |
| β-strand | 1200-1201 | 2 | 3 |
| α-helix | 1207-1209 | 3 | |
| β-strand | 1210-1212 | 3 | 2 |
| β-strand | 1218-1220 | 3 | 2 |
| β-strand | 1227-1228 | 2 | 3 |
| β-strand | 1235-1236 | 2 | 4 |
| α-helix | 1247-1249 | 3 | |
| α-helix | 1252-1257 | 6 | |
| β-strand | 1259-1260 | 2 | 4 |
| α-helix | 1262-1277 | 16 | |
| α-helix | 1281-1282 | 2 | |
| α-helix | 1289-1291 | 3 | |
| α-helix | 1292-1297 | 6 | |
| α-helix | 1302-1305 | 4 | |
| α-helix | 1310-1319 | 10 | |
| α-helix | 1324-1326 | 3 | |
| α-helix | 1328-1329 | 2 | |
| α-helix | 1330-1343 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hepatocyte growth factor receptor | A | protein | 307 | Homo sapiens | P08581 (AlphaFold model) |
>3Q6W_1 Hepatocyte growth factor receptor (chains A) QNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHC AVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRN FIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLAR DMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDV NTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGE HHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| Q6W | 3-{5-oxo-3-[1-(piperidin-4-yl)-1H-pyrazol-4-yl]-5H-benzo[4,5]cyclohepta[1,2-b]p… | C31 H30 N6 O2 | 1 |
Structural basis for selective small molecule kinase inhibition of activated c-Met. Rickert, K.W., Patel, S.B., Allison, T.J. et al. J Biol Chem (2011) 286:11218-11225. DOI 10.1074/jbc.M110.204404 · PubMed
Other PDB entries of the same protein (UniProt P08581 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3Q6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.