E. coli RecO complex with SSB C-terminus. Determined by X-ray diffraction at 2.3 Å resolution. Released 4 May 2011.
Explore 3Q8D in 3D Show helices and sheets RCSB PDB PDBe
3Q8D contains 21 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-14 | 10 | 1 |
| β-strand | 20-26 | 7 | 1 |
| β-strand | 30-36 | 7 | 1 |
| α-helix | 46-49 | 4 | |
| β-strand | 56-61 | 6 | 1 |
| β-strand | 66-74 | 9 | 1 |
| α-helix | 84-99 | 16 | |
| α-helix | 100-101 | 2 | |
| β-strand | 102 | 1 | 1 |
| α-helix | 107-121 | 15 | |
| α-helix | 128-142 | 15 | |
| β-strand | 150 | 1 | 2 |
| α-helix | 156 | 1 | |
| β-strand | 157 | 1 | 2 |
| α-helix | 158 | 1 | |
| β-strand | 163-167 | 5 | 3 |
| β-strand | 171-174 | 4 | 3 |
| β-strand | 182-184 | 3 | 3 |
| α-helix | 185-193 | 9 | |
| α-helix | 199-213 | 15 | |
| α-helix | 214-216 | 3 | |
| α-helix | 221-222 | 2 | |
| α-helix | 223-229 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-14 | 10 | 4 |
| β-strand | 20-26 | 7 | 4 |
| β-strand | 30-36 | 7 | 4 |
| α-helix | 46-49 | 4 | |
| β-strand | 56-61 | 6 | 4 |
| β-strand | 67-74 | 8 | 4 |
| α-helix | 84-99 | 16 | |
| α-helix | 100-101 | 2 | |
| β-strand | 102 | 1 | 4 |
| α-helix | 107-122 | 16 | |
| α-helix | 128-142 | 15 | |
| β-strand | 150 | 1 | 5 |
| β-strand | 157 | 1 | 5 |
| β-strand | 163-167 | 5 | 6 |
| β-strand | 171-174 | 4 | 6 |
| β-strand | 182-184 | 3 | 6 |
| α-helix | 185-193 | 9 | |
| α-helix | 199-217 | 19 | |
| α-helix | 221-222 | 2 | |
| α-helix | 224-231 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA repair protein recO | A, B | protein | 242 | Escherichia coli | P0A7H3 (AlphaFold model) |
| Single-stranded DNA-binding protein | E, F | protein | 10 | Escherichia coli | P0AGE0 (AlphaFold model) |
>3Q8D_1 DNA repair protein recO (chains A, B) MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRF GGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSL AGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDN KTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTH YE
>3Q8D_2 Single-stranded DNA-binding protein (chains E, F) YMDFDDDIPF
| ID | Name | Formula | Copies |
|---|---|---|---|
| CPS | 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate | C32 H58 N2 O7 S | 1 |
| MLT | D-malate | C4 H6 O5 | 1 |
Water and common crystallization additives (GOL) are not listed.
Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein. Ryzhikov, M., Koroleva, O., Postnov, D. et al. Nucleic Acids Res (2011) 39:6305-6314. DOI 10.1093/nar/gkr199 · PubMed
MolViewer shows 3Q8D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.