Crystal structure of the humanized apo LT3015 anti-lysophosphatidic acid antibody Fab fragment. Determined by X-ray diffraction at 2.15 Å resolution. Released 30 Mar 2011.
Explore 3QCT in 3D Show helices and sheets RCSB PDB PDBe
3QCT contains 19 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| α-helix | 7-8 | 2 | |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-24 | 7 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 2 |
| β-strand | 45-52 | 8 | 2 |
| β-strand | 56-59 | 4 | 2 |
| α-helix | 61-63 | 3 | |
| β-strand | 64 | 1 | 1 |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 2 |
| β-strand | 100D-103 | 5 | 2 |
| β-strand | 107-111 | 5 | 2 |
| β-strand | 117 | 1 | 3 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 4 |
| β-strand | 135-145 | 11 | 4 |
| β-strand | 146 | 1 | 3 |
| β-strand | 151-154 | 4 | 5 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 5 |
| β-strand | 163-165 | 3 | 4 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-170 | 2 | 4 |
| β-strand | 176-185 | 10 | 4 |
| α-helix | 186-188 | 3 | |
| β-strand | 194-200 | 7 | 5 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-211 | 7 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 6 |
| β-strand | 10-13 | 4 | 7 |
| β-strand | 19-25 | 7 | 6 |
| β-strand | 27C | 1 | 8 |
| β-strand | 31 | 1 | 8 |
| β-strand | 33-38 | 6 | 7 |
| α-helix | 43-44 | 2 | |
| β-strand | 45-49 | 5 | 7 |
| β-strand | 53-54 | 2 | 7 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 6 |
| β-strand | 70-75 | 6 | 6 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 7 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 7 |
| β-strand | 102-106 | 5 | 7 |
| β-strand | 111 | 1 | 9 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 10 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 10 |
| β-strand | 140 | 1 | 9 |
| β-strand | 145-150 | 6 | 11 |
| β-strand | 153-154 | 2 | 11 |
| α-helix | 155 | 1 | |
| β-strand | 159-163 | 5 | 10 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 10 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-197 | 7 | 11 |
| β-strand | 205-210 | 6 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| LT3015 antibody Fab fragment, heavy chain | H | protein | 223 | Homo sapiens | Q6N089 (AlphaFold model) |
| LT3015 antibody Fab fragment, light chain | L | protein | 218 | Homo sapiens | P01834 (AlphaFold model) |
>3QCT_1 LT3015 antibody Fab fragment, heavy chain (chains H) EVQLVQSGAEVKKPGESLKISCQAFGYGFINYLIEWIRQMPGQGLEWIGLINPGSDYTNY NENFKGQATLSADKSSSTAYLQWSSLKASDTAMYFCARRFGYYGSGNYFDYWGQGTMVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
>3QCT_2 LT3015 antibody Fab fragment, light chain (chains L) DVVMTQTPLSLPVTPGEPASISCTSGQSLVHINGNTYLHWYLQKPGQSPKLLIYKVSNLF SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQSTHFPFTFGQGTKLEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
Biochemical and structural characterization of lysophosphatidic Acid binding by a humanized monoclonal antibody. Fleming, J.K., Wojciak, J.M., Campbell, M.A. et al. J Mol Biol (2011) 408:462-476. DOI 10.1016/j.jmb.2011.02.061 · PubMed
Other PDB entries of the same protein (UniProt Q6N089 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3QCT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.