Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the C-terminal residues (ESESKV) of GIRK3. Determined by X-ray diffraction at 1.68 Å resolution. Released 16 Mar 2011.
Explore 3QE1 in 3D Show helices and sheets RCSB PDB PDBe
3QE1 contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 40-45 | 6 | 1 |
| β-strand | 47 | 1 | 2 |
| β-strand | 50 | 1 | 2 |
| β-strand | 53-56 | 4 | 1 |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 3 |
| β-strand | 72-73 | 2 | 3 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 87-91 | 5 | |
| β-strand | 98-102 | 5 | 1 |
| β-strand | 105-106 | 2 | 1 |
| α-helix | 112-121 | 10 | |
| β-strand | 125-131 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sorting nexin-27, G protein-activated inward rectifier potassium channel 3 chimera | A | protein | 107 | Rattus norvegicus | Q63511 (AlphaFold model), Q8K4V4 (AlphaFold model) |
>3QE1_1 Sorting nexin-27, G protein-activated inward rectifier potassium channel 3 chimera (chains A) GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAG VRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSVESESKV
Mechanism underlying selective regulation of G protein-gated inwardly rectifying potassium channels by the psychostimulant-sensitive sorting nexin 27. Balana, B., Maslennikov, I., Kwiatkowski, W. et al. Proc Natl Acad Sci U S A (2011) 108:5831-5836. DOI 10.1073/pnas.1018645108 · PubMed
Other PDB entries of the same protein (UniProt Q63511 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3QE1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.