3QIL: Clathrin heavy chain 1

Crystal structure analysis of the clathrin trimerization domain. Determined by X-ray diffraction at 3.92 Å resolution. Released 1 Feb 2012.

Method: X-ray diffraction
Resolution: 3.92 Å
Organism: Bos taurus
Chains: 24
Atoms: 23,032
Mol. weight: 354.21 kDa
Released: 1 Feb 2012

Explore 3QIL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QIL contains 139 α-helices and 0 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, G, M and P: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	1536-1539	4
α-helix	1548-1557	10
α-helix	1563-1573	11
α-helix	1581-1584	4
α-helix	1599-1616	18

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	1532-1544	13
α-helix	1548-1558	11
α-helix	1563-1574	12
α-helix	1584-1586	3
α-helix	1602-1620	19

Chains C, L and U: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	1537-1541	5
α-helix	1547-1555	9
α-helix	1569-1572	4
α-helix	1581-1584	4
α-helix	1604-1621	18

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	1536-1539	4
α-helix	1548-1557	10
α-helix	1563-1573	11
α-helix	1581-1584	4
α-helix	1599-1617	19

Chain E: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	1532-1537	6
α-helix	1538-1540	3
α-helix	1548-1552	5
α-helix	1555-1557	3
α-helix	1563-1574	12
α-helix	1581-1584	4
α-helix	1602-1620	19

Chains F and O: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	1537-1540	4
α-helix	1541-1543	3
α-helix	1547-1555	9
α-helix	1569-1572	4
α-helix	1581-1584	4
α-helix	1604-1621	18

Chain H: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	1532-1537	6
α-helix	1541-1544	4
α-helix	1548-1552	5
α-helix	1555-1557	3
α-helix	1563-1574	12
α-helix	1581-1584	4
α-helix	1585-1587	3
α-helix	1602-1620	19

Chain I: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	1537-1541	5
α-helix	1547-1555	9
α-helix	1569-1572	4
α-helix	1581-1584	4
α-helix	1585-1587	3
α-helix	1604-1621	18

9 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Clathrin heavy chain 1	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X	protein	125	Bos taurus	P49951 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X), FASTA

>3QIL_1 Clathrin heavy chain 1 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X)
MGSSHHHHHHSSGLVPRGSHMWKQSVELAKKDSLYKDAMQYASESKDTELAEELLQWFLQ
EEKRECFGACLFTCYDLLRPDVVLELAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESL
RKEEE

Primary citation

Nuclear localization of clathrin involves a labile helix outside the trimerization domain. Ybe, J.A., Fontaine, S.N., Stone, T. et al. FEBS Lett (2013) 587:142-149. DOI 10.1016/j.febslet.2012.11.005 · PubMed

Other PDB entries of the same protein (UniProt P49951 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M5T 1.7 Å, Clathrin heavy chain N-terminal domain bound to a non-natural clathrin-box motif peptide…
9F8T 1.71 Å, Clathrin terminal domain complexed with C-terminus of AAK1L
5M5R 1.76 Å, Clathrin heavy chain N-terminal domain bound to beta2 adaptin clathrin box motif
5M61 1.84 Å, Clathrin heavy chain N-terminal domain bound to an extended amphiphysin clathrin-box motif
5M5S 1.88 Å, Clathrin heavy chain N-terminal domain bound to amphiphysin clathrin-box motif
5M5V 1.96 Å, Clathrin heavy chain N-terminal domain bound to a clathrin-box motif from hepatitis D…
5M5U 2.15 Å, Clathrin heavy chain N-terminal domain bound to a clathrin-box motif from hepatitis D…
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
1UTC 2.3 Å, Clathrin terminal domain complexed with TLPWDLWTT
1B89 2.6 Å, Clathrin heavy chain proximal leg segment (BOVINE)
3GD1 3.5 Å, Structure of an Arrestin/Clathrin complex reveals a novel clathrin binding domain that…
6WCJ 6.3 Å, Asymmetric vertex of the clathrin minicoat cage

Browse structure collections

About this viewer

MolViewer shows 3QIL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.