9F8T: Clathrin terminal domain

Clathrin terminal domain complexed with C-terminus of AAK1L. Determined by X-ray diffraction at 1.71 Å resolution. Released 21 May 2025.

Method: X-ray diffraction
Resolution: 1.71 Å
Organisms: Bos taurus, Homo sapiens
Chains: 3
Atoms: 3,368
Mol. weight: 41.83 kDa
Released: 21 May 2025

Explore 9F8T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9F8T contains 14 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	7-14	8	1
α-helix	15-18	4
α-helix	22-24	3
β-strand	30-34	5	2
β-strand	37-44	8	2
β-strand	47-54	8	2
β-strand	62-65	4	2
β-strand	66	1	3
β-strand	70-73	4	4
β-strand	79-84	6	4
β-strand	87-92	6	4
β-strand	97-103	7	4
β-strand	108-113	6	5
β-strand	118-123	6	5
β-strand	126-131	6	5
β-strand	139-143	5	5
α-helix	144-145	2
α-helix	146-148	3
α-helix	151	1
β-strand	152-158	7	6
β-strand	164-173	10	6
β-strand	176-185	10	6
β-strand	190-195	6	6
β-strand	198-204	7	7
α-helix	212	1
β-strand	213-222	10	7
β-strand	225-232	8	7
α-helix	240-245	6
β-strand	246-250	5	7
α-helix	254-256	3
β-strand	261-267	7	8
β-strand	272-277	6	8
β-strand	281-286	6	8
β-strand	292-297	6	8
α-helix	302	1
β-strand	303-309	7	1
α-helix	310-312	3
β-strand	314-319	6	1
β-strand	323-329	7	1
α-helix	334-336	3
α-helix	337-341	5
α-helix	345-355	11

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	959	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Clathrin heavy chain 1	A	protein	363	Bos taurus	P49951 (AlphaFold model)
AP2-associated protein kinase 1	D, E	protein	6	Homo sapiens	Q2M2I8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9F8T_1 Clathrin heavy chain 1 (chains A)
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EEL

Sequence of entity 2 (D, E), FASTA

>9F8T_2 AP2-associated protein kinase 1 (chains D, E)
DQLIDL

Primary citation

Clathrin terminal domain complexed with C-terminus of AAK1L. Wrobel, A.G., Owen, D.J., Kadlecova, Z. To be published.

Other PDB entries of the same protein (UniProt P49951 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M5T 1.7 Å, Clathrin heavy chain N-terminal domain bound to a non-natural clathrin-box motif peptide…
5M5R 1.76 Å, Clathrin heavy chain N-terminal domain bound to beta2 adaptin clathrin box motif
5M61 1.84 Å, Clathrin heavy chain N-terminal domain bound to an extended amphiphysin clathrin-box motif
5M5S 1.88 Å, Clathrin heavy chain N-terminal domain bound to amphiphysin clathrin-box motif
5M5V 1.96 Å, Clathrin heavy chain N-terminal domain bound to a clathrin-box motif from hepatitis D…
5M5U 2.15 Å, Clathrin heavy chain N-terminal domain bound to a clathrin-box motif from hepatitis D…
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
1UTC 2.3 Å, Clathrin terminal domain complexed with TLPWDLWTT
1B89 2.6 Å, Clathrin heavy chain proximal leg segment (BOVINE)
3GD1 3.5 Å, Structure of an Arrestin/Clathrin complex reveals a novel clathrin binding domain that…
3QIL 3.92 Å, Crystal structure analysis of the clathrin trimerization domain
6WCJ 6.3 Å, Asymmetric vertex of the clathrin minicoat cage

Browse structure collections

About this viewer

MolViewer shows 9F8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.