3QIS: Inositol polyphosphate 5-phosphatase OCRL-1

Recognition of the F&H motif by the Lowe Syndrome protein OCRL. Determined by X-ray diffraction at 2.3 Å resolution. Released 15 Jun 2011.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,631
Mol. weight: 44.24 kDa
Released: 15 Jun 2011

Explore 3QIS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QIS contains 12 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	565-567	3	1
β-strand	571-577	7	2
β-strand	579	1	3
β-strand	583-591	9	1
β-strand	597-602	6	2
β-strand	615-618	4	1
β-strand	621-624	4	2
β-strand	629-636	8	1
β-strand	638	1	3
α-helix	643-648	6
β-strand	655-661	7	2
β-strand	666-675	10	2
α-helix	684-689	6
α-helix	736-748	13
α-helix	762-774	13
α-helix	784-797	14
α-helix	805-814	10
α-helix	818-826	9
α-helix	830-847	18
α-helix	850-853	4
α-helix	857-868	12
α-helix	883-895	13

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inositol polyphosphate 5-phosphatase OCRL-1	A	protein	366	Homo sapiens	Q01968 (AlphaFold model)
Protein FAM109A	B	protein	13	Homo sapiens	Q8N4B1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QIS_1 Inositol polyphosphate 5-phosphatase OCRL-1 (chains A)
KVVDERRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQV
PCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIED
ILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEK
SLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTS
IPETIPGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNV
FRYLMAFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFL
LGSEED

Sequence of entity 2 (B), FASTA

>3QIS_2 Protein FAM109A (chains B)
PFARLHECYGQEI

Primary citation

Recognition of the F&H motif by the Lowe syndrome protein OCRL. Pirruccello, M., Swan, L.E., Folta-Stogniew, E. et al. Nat Struct Mol Biol (2011) 18:789-795. DOI 10.1038/nsmb.2071 · PubMed

Other PDB entries of the same protein (UniProt Q01968 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QBT 2.0 Å, Crystal structure of OCRL1 540-678 in complex with Rab8a:GppNHp
2QV2 2.4 Å, A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway
4CMN 3.13 Å, Crystal structure of OCRL in complex with a phosphate ion
2KIE A PH domain within OCRL bridges clathrin mediated membrane trafficking to…

Browse structure collections

About this viewer

MolViewer shows 3QIS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.