3QKG: Alpha-1-microglobulin

Crystal structure of alpha-1-microglobulin at 2.3 A resolution. Determined by X-ray diffraction at 2.3 Å resolution. Released 8 Feb 2012.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,371
Mol. weight: 22.11 kDa
Ligands: NI
Released: 8 Feb 2012

Explore 3QKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QKG contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	12-13	2
α-helix	18-21	4
β-strand	23-32	10	1
α-helix	35-40	6
β-strand	45	1	2
β-strand	47-53	7	1
β-strand	59-67	9	1
β-strand	72-81	10	1
β-strand	87-92	6	1
β-strand	97-106	10	1
β-strand	111-118	8	1
α-helix	125	1
β-strand	126-133	8	1
α-helix	140-152	13
β-strand	160-162	3	1
α-helix	163	1
β-strand	164	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein AMBP	A	protein	193	Homo sapiens	P02760 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QKG_1 Protein AMBP (chains A)
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTSPWLKKIMDRMTVSTLVLGEGATEAEI
SMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFS
RHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPIL
IPRSAWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

The crystal structure of human alpha(1)-microglobulin reveals a potential haem-binding site. Meining, W., Skerra, A. Biochem J (2012) 445:175-182. DOI 10.1042/BJ20120448 · PubMed

Other PDB entries of the same protein (UniProt P02760 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6EJA 1.94 Å, Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG
6EJ7 2.0 Å, Human Xylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG
4ES7 2.0 Å, crystal structure of protein HC from Homo sapiens at 2 angstrom
6EJ9 2.02 Å, Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG
6EJC 2.06 Å, Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG
6EJ8 2.09 Å, Human Xylosyltransferase 1 in complex with peptide QEEEGSGGGQGG
1BIK 2.5 Å, X-ray structure of bikunin from the human inter-alpha-inhibitor complex
4U30 2.5 Å, Human mesotrypsin complexed with bikunin Kunitz domain 2
6EJB 2.56 Å, Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG
6EJD 2.68 Å, Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG

Browse structure collections

About this viewer

MolViewer shows 3QKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.