Human Xylosyltransferase 1 in complex with peptide QEEEGSGGGQGG. Determined by X-ray diffraction at 2.09 Å resolution. Released 2 May 2018.
Explore 6EJ8 in 3D Show helices and sheets RCSB PDB PDBe
6EJ8 contains 37 α-helices and 37 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 262-270 | 9 | |
| α-helix | 274-288 | 15 | |
| β-strand | 296 | 1 | 1 |
| α-helix | 315-319 | 5 | |
| β-strand | 328-334 | 7 | 2 |
| α-helix | 339-349 | 11 | |
| β-strand | 355-360 | 6 | 2 |
| α-helix | 365-377 | 13 | |
| β-strand | 381-383 | 3 | 2 |
| α-helix | 396-410 | 15 | |
| β-strand | 418-422 | 5 | 2 |
| β-strand | 426-428 | 3 | 3 |
| α-helix | 432-441 | 10 | |
| β-strand | 446-448 | 3 | 2 |
| β-strand | 450 | 1 | 4 |
| α-helix | 455-462 | 8 | |
| β-strand | 466-470 | 5 | 5 |
| β-strand | 475-480 | 6 | 5 |
| α-helix | 482-484 | 3 | |
| β-strand | 485 | 1 | 1 |
| β-strand | 492 | 1 | 4 |
| β-strand | 497-499 | 3 | 2 |
| α-helix | 500-508 | 9 | |
| α-helix | 512-520 | 9 | |
| α-helix | 521-523 | 3 | |
| α-helix | 527-529 | 3 | |
| α-helix | 531-538 | 8 | |
| α-helix | 542-544 | 3 | |
| β-strand | 545-547 | 3 | 2 |
| β-strand | 551-553 | 3 | 3 |
| α-helix | 557-560 | 4 | |
| β-strand | 569 | 1 | 5 |
| β-strand | 573 | 1 | 6 |
| α-helix | 576-579 | 4 | |
| α-helix | 581-588 | 8 | |
| β-strand | 596-598 | 3 | 3 |
| α-helix | 607-617 | 11 | |
| α-helix | 619-621 | 3 | |
| β-strand | 629-636 | 8 | 7 |
| α-helix | 637-639 | 3 | |
| α-helix | 641-643 | 3 | |
| α-helix | 646-666 | 21 | |
| β-strand | 677-691 | 15 | 7 |
| β-strand | 694-706 | 13 | 7 |
| β-strand | 711-721 | 11 | 7 |
| α-helix | 722-723 | 2 | |
| β-strand | 726-727 | 2 | 8 |
| β-strand | 737-743 | 7 | 9 |
| β-strand | 746-747 | 2 | 10 |
| β-strand | 752-753 | 2 | 10 |
| β-strand | 767-772 | 6 | 9 |
| β-strand | 778-785 | 8 | 8 |
| β-strand | 791-799 | 9 | 8 |
| β-strand | 805-808 | 4 | 9 |
| α-helix | 816-818 | 3 | |
| β-strand | 819-827 | 9 | 8 |
| β-strand | 830-839 | 10 | 8 |
| α-helix | 840-842 | 3 | |
| β-strand | 844-845 | 2 | 11 |
| β-strand | 848-849 | 2 | 11 |
| α-helix | 850-851 | 2 | |
| α-helix | 852-858 | 7 | |
| α-helix | 873-875 | 3 | |
| α-helix | 876-879 | 4 | |
| α-helix | 882-884 | 3 | |
| α-helix | 885-895 | 11 | |
| α-helix | 899-913 | 15 | |
| β-strand | 914-921 | 8 | 7 |
| α-helix | 930-931 | 2 | |
| β-strand | 932 | 1 | 7 |
| α-helix | 933-935 | 3 | |
| α-helix | 945-947 | 3 | |
| α-helix | 951-953 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 216 | 1 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Xylosyltransferase 1 | A | protein | 755 | Homo sapiens | Q86Y38 (AlphaFold model) |
| Protein AMBP | B | protein | 12 | Homo sapiens | P02760 (AlphaFold model) |
>6EJ8_1 Xylosyltransferase 1 (chains A) RALAAPLVHHHHHHALDENLYFQGALADVSRPPHARKTGGSSPETKYDQPPKCDISGKEA ISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPAN PVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVT PWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRD MNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVE YVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQ YKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEIIGQLDYYLYGNYPAGT PGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPA SVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRLQFSEVGT DWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDPVNVIAATYDILIESTAE FTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEALKLHNGPLR NAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDICATGP TACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
>6EJ8_2 Protein AMBP (chains B) QEEEGSGGGQGG
Water and common crystallization additives (NA) are not listed.
Structural Basis for the Initiation of Glycosaminoglycan Biosynthesis by Human Xylosyltransferase 1. Briggs, D.C., Hohenester, E. Structure (2018) 26:801-809.e3. DOI 10.1016/j.str.2018.03.014 · PubMed
Other PDB entries of the same protein (UniProt Q86Y38 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6EJ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.